Property Summary

NCBI Gene PubMed Count 39
Grant Count 50
R01 Count 33
Funding $2,296,974.33
PubMed Score 21.70
PubTator Score 20.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.689 0.000
primary pancreatic ductal adenocarcinoma 1.073 0.011
non-small cell lung cancer 1.001 0.000
lung cancer 1.100 0.046
sonic hedgehog group medulloblastoma 1.300 0.000
ovarian cancer 3.100 0.000

Gene RIF (24)

PMID Text
26030842 MAF1, RNF7 and SETD3 are identified as PCNA-associated proteins in human cells and given this interaction with PCNA, Maf1, RNF7, and SetD3 are potentially involved in DNA replication, DNA repair, or associated processes.
25912140 These findings indicate that Rbx1 and Rbx2 can both activate Cul5-Vif E3 ligase in vitro, but they may undergo a more delicate selection mechanism in vivo.
25912140 Rbx1 I44A and Rbx2 I52A mutants disrupt the level of HIV-1 Vif-mediated APOBEC3G degradation in cells
25912140 Rbx1 I44A and Rbx2 I52A mutants disrupt the level of HIV-1 Vif-mediated APOBEC3G degradation in cells
25142583 Rbx1 I44A and Rbx2 I52A mutants disrupt the level of HIV-1 Vif-mediated APOBEC3G degradation in cells
24390320 Rbx1 I44A and Rbx2 I52A mutants disrupt the level of HIV-1 Vif-mediated APOBEC3G degradation in cells
24390320 Rbx1 I44A and Rbx2 I52A mutants disrupt the level of HIV-1 Vif-mediated APOBEC3G degradation in cells
23300442 Rbx1 I44A and Rbx2 I52A mutants disrupt the level of HIV-1 Vif-mediated APOBEC3G degradation in cells
23300442 Rbx1 I44A and Rbx2 I52A mutants disrupt the level of HIV-1 Vif-mediated APOBEC3G degradation in cells
22841784 Single nucleotide polymorphism rs16851720 was associated with liver fibrosis progression.
More...

AA Sequence

MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ      1 - 70
EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK                                71 - 113
//

Text Mined References (42)

PMID Year Title
26030842 2015 A fluorescent bimolecular complementation screen reveals MAF1, RNF7 and SETD3 as PCNA-associated proteins in human cells.
25912140 2015 Both Rbx1 and Rbx2 exhibit a functional role in the HIV-1 Vif-Cullin5 E3 ligase complex in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
22841784 2012 Genome-wide association study identifies variants associated with progression of liver fibrosis from HCV infection.
22405651 2012 The glomuvenous malformation protein Glomulin binds Rbx1 and regulates cullin RING ligase-mediated turnover of Fbw7.
22190034 2011 Global landscape of HIV-human protein complexes.
22171132 2011 Prognostic role of sensitive-to-apoptosis gene expression in rectal cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20933570 2011 Sensitive to apoptosis gene protein regulates ionizing radiation-induced apoptosis.
20103673 2010 Validation of SAG/RBX2/ROC2 E3 ubiquitin ligase as an anticancer and radiosensitizing target.
More...