Property Summary

NCBI Gene PubMed Count 40
PubMed Score 25.23
PubTator Score 20.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.100 4.6e-02
Multiple myeloma 1.689 1.4e-04
non-small cell lung cancer 1.001 6.4e-14
ovarian cancer 3.100 1.9e-07
primary pancreatic ductal adenocarcinoma 1.073 1.1e-02
sonic hedgehog group medulloblastoma 1.300 1.1e-05

Gene RIF (21)

AA Sequence

MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ      1 - 70
EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK                                71 - 113
//

Text Mined References (43)

PMID Year Title