Property Summary

NCBI Gene PubMed Count 36
Grant Count 7
R01 Count 5
Funding $1,542,512.34
PubMed Score 95.87
PubTator Score 13.53

Knowledge Summary

Patent

No data available

Gene RIF (23)

PMID Text
26540345 Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells.
26321295 MAGE-C1 and MAGE-C2 expressions were positively associated with high tumor grade and reduced recurrence-free survival in breast cancer.
26161400 expression of CT7 and CT10 throughout the different subtypes of mucosal melanoma and tumor development.
24866244 overexpression of HCA587 resulted in a significant enhancement of LMP1-induced IL-6 production. These data indicate that HCA587 is a new negative regulator of BS69
24820892 MAGE-C1 and MAGE-C2 are expressed in myeloma, but the chromosome aberrations do not always correlate with expression
24713551 In gastrointestinal stromal tumors, 5/51 (10%) patients expressed MAGE-C2. High-grade GIST are more likely to express MAGE-C2. MAGE-C2 also significantly correlates with mitotic rate and tumor size.
24687377 Our results indicate that MAGEC2 has a role in breast cancer metastasis through inducing epithelial-mesenchymal transition
23180015 the present study confirmed MAGE-C1/CT7 and MAGE-C2/CT7 expression in monoclonal gammopathies
23096706 MAGE-C2 promotes growth and tumorigenicity of melanoma cells, phosphorylation of KAP1, and DNA damage repair.
22925930 Cytotoxic T cell clones directed against MAGE-C2 peptides recognize EB81-melanoma tumor cells treated with interferon (IotaFN)-gamma.
More...

AA Sequence

MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPSSFSTSSSLILGGPEEEE      1 - 70
VPSGVIPNLTESIPSSPPQGPPQGPSQSPLSSCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYT     71 - 140
LDEKVAELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGLALIEVGPDHFCVFAN    141 - 210
TVGLTDEGSDDEGMPENSLLIIILSVIFIKGNCASEEVIWEVLNAVGVYAGREHFVYGEPRELLTKVWVQ    211 - 280
GHYLEYREVPHSSPPYYEFLWGPRAHSESIKKKVLEFLAKLNNTVPSSFPSWYKDALKDVEERVQATIDT    281 - 350
ADDATVMASESLSVMSSNVSFSE                                                   351 - 373
//

Text Mined References (40)

PMID Year Title
26540345 2015 Cancer-testis antigen MAGE-C2 binds Rbx1 and inhibits ubiquitin ligase-mediated turnover of cyclin E.
26321295 2016 The expression of MAGE-C1 and MAGE-C2 in breast cancer and their clinical significance.
26161400 2015 Intratumoral Heterogeneity of MAGE-C1/CT7 and MAGE-C2/CT10 Expression in Mucosal Melanoma.
25416956 2014 A proteome-scale map of the human interactome network.
24866244 2014 Cancer-testis antigen HCA587/MAGE-C2 interacts with BS69 and promotes its degradation in the ubiquitin-proteasome pathway.
24820892 2015 Chromosomal aberrations of cancer-testis antigens in myeloma patients.
24713551 2014 Expression of cancer testis antigens CT10 (MAGE-C2) and GAGE in gastrointestinal stromal tumors.
24687377 2014 MAGEC2, an epithelial-mesenchymal transition inducer, is associated with breast cancer metastasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180015 2013 MAGE-C1/CT7 and MAGE-C2/CT10 are frequently expressed in multiple myeloma and can be explored in combined immunotherapy for this malignancy.
More...