Property Summary

Ligand Count 3
NCBI Gene PubMed Count 69
PubMed Score 58.65
PubTator Score 56.13

Knowledge Summary

Patent (5,176)

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.500 4.4e-02
adrenocortical carcinoma -1.084 1.6e-02
adult high grade glioma -2.000 4.3e-04
astrocytic glioma -1.800 4.0e-03
Astrocytoma, Pilocytic -1.700 9.9e-06
atypical teratoid / rhabdoid tumor -2.000 6.8e-06
ependymoma -2.300 4.0e-03
gastric cancer 1.100 1.7e-03
glioblastoma -1.600 5.1e-07
group 4 medulloblastoma 1.100 3.4e-02
hepatocellular carcinoma 1.200 1.4e-05
lung cancer 1.100 1.1e-02
oligodendroglioma -1.300 1.4e-02
osteosarcoma -2.740 1.2e-08
ovarian cancer -1.200 4.4e-06
Parkinson's disease -1.100 3.6e-02
Pick disease -1.100 4.2e-02
primitive neuroectodermal tumor -1.300 1.2e-02
psoriasis -1.100 3.3e-03
Rheumatoid arthritis 1.200 1.1e-02

Protein-protein Interaction (7)

Gene RIF (45)

AA Sequence

MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSS      1 - 70
AAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEP     71 - 140
DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHID    141 - 210
YFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKI    211 - 280
CDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQL    281 - 350
DLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD    351 - 420
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQK    421 - 490
GNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE                                     491 - 527
//

Text Mined References (76)

PMID Year Title