Property Summary

NCBI Gene PubMed Count 65
PubMed Score 60.65
PubTator Score 56.13

Knowledge Summary

Patent (5,176)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.20810614267955E-8
atypical teratoid / rhabdoid tumor 4369 8.63602006484676E-7
glioblastoma 5572 1.43720205176181E-6
pediatric high grade glioma 2712 5.19483561155905E-6
pilocytic astrocytoma 3086 1.01591827628705E-5
hepatocellular carcinoma 550 1.37384456081043E-5
lung cancer 4473 2.00101632820095E-4
sonic hedgehog group medulloblastoma 1482 2.98050426536311E-4
gastric cancer 436 0.00165982064754171
ependymoma 2514 0.00271729805750327
psoriasis 6685 0.00329322468065331
ovarian cancer 8492 0.00333143912740582
astrocytic glioma 2241 0.00364101970616349
Pick disease 1893 0.00470149966705063
primitive neuroectodermal tumor 3031 0.00785567379376876
Rheumatoid Arthritis 1171 0.010939674875943
oligodendroglioma 2849 0.0131274054850352
adrenocortical carcinoma 1427 0.0158759539117096
Parkinson's disease 364 0.0364890087491501
acute myeloid leukemia 785 0.043651335633605

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.011
gastric cancer 1.100 0.002
hepatocellular carcinoma 1.200 0.000
astrocytic glioma -2.000 0.004
ependymoma -2.400 0.003
oligodendroglioma -1.400 0.013
psoriasis -1.100 0.003
glioblastoma -2.600 0.000
osteosarcoma -2.740 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
primitive neuroectodermal tumor -1.400 0.008
adrenocortical carcinoma -1.084 0.016
lung cancer 1.800 0.000
Parkinson's disease -1.100 0.036
pediatric high grade glioma -2.000 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
pilocytic astrocytoma -1.700 0.000
Pick disease -1.400 0.005
acute myeloid leukemia -1.500 0.044
ovarian cancer 1.400 0.003

Synonym

Accession Q9UBE8 B2RCX1 Q2PNI9 Q6P2A3
Symbols

Gene

NLK

  Ortholog (13)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (42)

PMID Text
26823848 The expression of NLK was negatively correlated with TCF4 expression in lung cancers
26647877 Further experiments demonstrated that the overexpression of miR3623p resulted in decrease expression levels of nemo-like kinase
26588989 NLK phosphorylates Raptor on S863 to disrupt its interaction with the Rag GTPase, which is important for mTORC1 lysosomal recruitment.
26503628 NLK was involved in miR-92b-induced cell proliferation, and its protein level was obviously downregulated in the miR-92b-overexpressing xenograft tumors.
26503334 Data show that metformin inhibits nemo like kinase (NLK) expression and might be a potential treatment strategy for non-small cell lung cancer (NSCLC).
26427665 In this review, we will make a summary on the comprehensive roles of NLK in the regulation of various cancers
26269673 NLK overexpression is an independent prognostic factor in colorectal cancer and knockdown of NLK expression inhibits colorectal cancer progression and metastasis.
26252054 Down-regulation of NLK inhibited tumorigenesis and up-regulated the expression of cell cycle proteins in laryngeal cancer cells.
26022162 NLK overexpression is associated with poor overall survival in patients with hepatocellular carcinoma(HCC), it might be an independent poor prognostic marker for HCC.
25833695 our work first demonstrated that miR-197 can confer drug resistance to Taxol, by regulating tumor suppressor, NLK expression in ovarian cancer cells.
More...

AA Sequence

MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSS      1 - 70
AAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEP     71 - 140
DRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHID    141 - 210
YFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKI    211 - 280
CDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQL    281 - 350
DLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD    351 - 420
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQK    421 - 490
GNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE                                     491 - 527
//

Text Mined References (72)

PMID Year Title
26823848 2015 Expression of Nemo-like kinase was increased and negatively correlated with the expression of TCF4 in lung cancers.
26647877 2016 miR-362-3p targets nemo-like kinase and functions as a tumor suppressor in renal cancer cells.
26588989 2015 NLK phosphorylates Raptor to mediate stress-induced mTORC1 inhibition.
26503628 2015 MicroRNA-92b promotes tumor growth and activation of NF-?B signaling via regulation of NLK in oral squamous cell carcinoma.
26503334 2015 NLK functions to maintain proliferation and stemness of NSCLC and is a target of metformin.
26427665 2015 The emerging role of Nemo-like kinase (NLK) in the regulation of cancers.
26269673 2015 Upregulation of nemo-like kinase is an independent prognostic factor in colorectal cancer.
26252054 2015 Lentivirus?delivered nemo?like kinase small interfering RNA inhibits laryngeal cancer cell proliferation in vitro.
26022162 2015 Prognostic significance of Nemo-like kinase expression in patients with hepatocellular carcinoma.
25833695 2015 MiR-197 induces Taxol resistance in human ovarian cancer cells by regulating NLK.
More...