Property Summary

NCBI Gene PubMed Count 31
PubMed Score 27.89
PubTator Score 22.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.160 2.2e-02
astrocytic glioma -1.600 3.1e-02
atypical teratoid/rhabdoid tumor 1.300 8.2e-03
lung cancer 1.900 5.4e-04
medulloblastoma 1.100 1.1e-02
osteosarcoma 2.365 3.4e-06
ovarian cancer 2.000 2.2e-05
Rheumatoid arthritis -1.300 1.6e-02

Gene RIF (8)

AA Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ      1 - 70
VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV     71 - 140
KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK    141 - 210
VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL    211 - 280
GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK        281 - 346
//

Text Mined References (38)

PMID Year Title