Property Summary

NCBI Gene PubMed Count 31
PubMed Score 26.87
PubTator Score 22.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.016
astrocytic glioma -1.600 0.031
osteosarcoma 2.365 0.000
medulloblastoma 1.100 0.011
adrenocortical carcinoma 1.160 0.022
lung cancer 1.900 0.001
atypical teratoid/rhabdoid tumor 1.300 0.008
ovarian cancer 2.000 0.000

Synonym

Accession Q9UBE0 B2RDP5 B3KMQ2 F5GXX7 G3XAK6 O95717 Q9P020
Symbols AOS1
SUA1
UBLE1A
HSPC140

Gene

PANTHER Protein Class (1)

PDB

1Y8R   3KYC   3KYD   1Y8Q  

Gene RIF (8)

PMID Text
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
25842831 as it has been shown by flow cytometry analysis, specific knockdown of SAE1 slowed down the cell population at G0/G1 phase and induced apoptosis of RKO cells.
22884621 Data indicate the role of anti-SUMO activating enzyme SAE1 and SAE2 antibody as marker of dermatomyositis.
22403398 Data show that the SAE2 subunit of the small ubiquitin-like modifier (SUMO) E1 is autoSUMOylated at residue Lys-236, and SUMOylation was catalyzed by Ubc9 at several additional Lys residues surrounding the catalytic Cys-173 of SAE2.
22157079 loss of SAE1/2 activity drives synthetic lethality with Myc; inactivation of SAE2 leads to mitotic catastrophe and cell death upon Myc hyperactivation; findings in Myc-high breast cancers suggest low tumor SAE1 and SAE2 correlates metastasis-free survival
21209321 The mammalian E1 subunits can be imported separately, identify nuclear localization signals (NLSs) in Aos1 and in Uba2, and demonstrate that their import is mediated by importin alpha/beta in vitro and in intact cells.
16421094 SUMO-1 controls the protein stability and the biological function of phosducin.
15660128 structures of heterodimeric Sae1/Sae2-Mg.ATP and Sae1/Sae2-SUMO-1-Mg.ATP complexes

AA Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ      1 - 70
VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV     71 - 140
KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK    141 - 210
VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL    211 - 280
GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK        281 - 346
//

Text Mined References (37)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
25842831 [Lentivirus-mediated siRNA targeting sae1 induces cell cycle arrest and apop- tosis in colon cancer cell RKO].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22884621 2012 Anti-SAE antibodies in autoimmune myositis: identification by unlabelled protein immunoprecipitation in an Italian patient cohort.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22403398 2012 Small ubiquitin-like modifier (SUMO) modification of E1 Cys domain inhibits E1 Cys domain enzymatic activity.
22157079 2012 A SUMOylation-dependent transcriptional subprogram is required for Myc-driven tumorigenesis.
More...