Property Summary

NCBI Gene PubMed Count 30
PubMed Score 120.74
PubTator Score 51.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis 1.400 4.6e-03
esophageal adenocarcinoma -5.100 1.9e-02
nasopharyngeal carcinoma -1.800 3.4e-05
non-small cell lung cancer 2.347 5.5e-08
psoriasis 3.500 2.0e-10
spina bifida -2.523 4.2e-02

Gene RIF (14)

AA Sequence

MAWNTNLRWRLPLTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLSDMENEFYYRYPSFQDVHVMV      1 - 70
FVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHFLQDRYIVVGVENLINADFCVASVCVAFG     71 - 140
AVLGKVSPIQLLIMTFFQVTLFAVNEFILLNLLKVKDAGGSMTIHTFGAYFGLTVTRILYRRNLEQSKER    141 - 210
QNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYCSLAACVLTSVAISSALHKKGKLDMV    211 - 280
HIQNATLAGGVAVGTAAEMMLMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGII    281 - 350
GGIVGAVTAASASLEVYGKEGLVHSFDFQGFNGDWTARTQGKFQIYGLLVTLAMALMGGIIVGLILRLPF    351 - 420
WGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP               421 - 479
//

Text Mined References (32)

PMID Year Title