Property Summary

NCBI Gene PubMed Count 30
Grant Count 16
R01 Count 13
Funding $2,818,858.1
PubMed Score 110.06
PubTator Score 51.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -5.100 0.019
psoriasis 5.200 0.000
non-small cell lung cancer 2.347 0.000
cystic fibrosis 1.400 0.005
nasopharyngeal carcinoma -1.800 0.000
spina bifida -2.523 0.042

Gene RIF (14)

PMID Text
26190573 The molecular mechanism of NH4(+) recruitment and NH3 transport by RHCG is described.
24647713 Rh B Glycoprotein (Rhbg) and Rh C Glycoprotein (Rhcg) are identified as ammonia transporters. They are expressed in specific cell populations and membrane domains in distal renal epithelial cells, where they facilitate ammonia secretion.
24077989 RhAG, RhBG and RhCG-exhibit significant permeability to NH3 and show for the first time that RhBG and RhCG can conduct CO2.
24021113 Amt and Rh proteins are not functionally equivalent and that permeation takes place according to two distinct mechanisms.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20457942 X-ray crystallographic structure of human RhCG, determined at 2.1 A resolution, reveals the mechanism of ammonia transport.
20126667 major finding of this study is that RhCG protein is active as an NH(3) channel and that this function does not require any protein partner
19913121 Observational study of gene-disease association. (HuGE Navigator)
19429772 Rhbg and Rhcg may contribute to bronchial epithelial cell ammonia metabolism and suggest that they do not contribute to pulmonary carbon dioxide transport.
19357182 This study concludes that under normal conditions, RhCG is the major putative ammonia transporter expressed in the human kidney and RhBG is not expressed at detectable levels.
More...

AA Sequence

MAWNTNLRWRLPLTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLSDMENEFYYRYPSFQDVHVMV      1 - 70
FVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHFLQDRYIVVGVENLINADFCVASVCVAFG     71 - 140
AVLGKVSPIQLLIMTFFQVTLFAVNEFILLNLLKVKDAGGSMTIHTFGAYFGLTVTRILYRRNLEQSKER    141 - 210
QNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYCSLAACVLTSVAISSALHKKGKLDMV    211 - 280
HIQNATLAGGVAVGTAAEMMLMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGII    281 - 350
GGIVGAVTAASASLEVYGKEGLVHSFDFQGFNGDWTARTQGKFQIYGLLVTLAMALMGGIIVGLILRLPF    351 - 420
WGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP               421 - 479
//

Text Mined References (32)

PMID Year Title
26190573 2015 Mechanism of NH4(+) Recruitment and NH3 Transport in Rh Proteins.
24647713 2014 Ammonia transport in the kidney by Rhesus glycoproteins.
24077989 2013 Relative CO?/NH? permeabilities of human RhAG, RhBG and RhCG.
24021113 2013 Different hydration patterns in the pores of AmtB and RhCG could determine their transport mechanisms.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20457942 2010 Function of human Rh based on structure of RhCG at 2.1 A.
20126667 2010 Functional reconstitution into liposomes of purified human RhCG ammonia channel.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19429772 2009 Expression of the gas-transporting proteins, Rh B glycoprotein and Rh C glycoprotein, in the murine lung.
More...