Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.20
PubTator Score 7.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Synonym

Accession Q9UBD3
Symbols SCM1B
SCYC2
SCM-1b

Gene

Gene RIF (5)

PMID Text
25497737 analysis of XCL1 and XCL2, members of the C-chemokine subfamily, in the immune system
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
25092091 S1P induced the macrophage-recruiting factor CCL2 expression in NB cells via S1P2, providing new insights into the complicated functions of S1P2 in cancer.
18618175 Wag31 was found to specifically stimulate XCL2 expression in macrophages
17763208 The G carrier of the -2510A/G promoter polymorphism was found to be associated with primary knee knee osteoarthritis among Koreans.

AA Sequence

MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCA      1 - 70
DPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG                               71 - 114
//

Text Mined References (15)

PMID Year Title
25497737 2015 Structural and agonist properties of XCL2, the other member of the C-chemokine subfamily.
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
25416956 2014 A proteome-scale map of the human interactome network.
25092091 2014 Induction of chemokine (C-C motif) ligand 2 by sphingosine-1-phosphate signaling in neuroblastoma.
18618175 2008 Mycobacterium tuberculosis antigen Wag31 induces expression of C-chemokine XCL2 in macrophages.
17763208 Association of the -2510A/G chemokine (C-C motif) ligand 2 polymorphism with knee osteoarthritis in a Korean population.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...