Property Summary

NCBI Gene PubMed Count 36
PubMed Score 50.68
PubTator Score 27.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
colon cancer 1.400 2.7e-03
cutaneous lupus erythematosus 3.500 3.3e-03
cystic fibrosis 4.700 7.1e-05
cystic fibrosis and chronic rhinosinusit... 1.125 1.5e-02
esophageal adenocarcinoma -4.400 2.4e-02
intraductal papillary-mucinous neoplasm ... 2.100 8.5e-03
lung cancer -4.900 1.8e-02
nasopharyngeal carcinoma -3.400 1.2e-04
non-small cell lung cancer 4.362 2.5e-10
pancreatic cancer 2.300 4.0e-03
psoriasis 1.200 1.4e-03

Gene RIF (13)

AA Sequence

MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP      1 - 70
EPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTK     71 - 140
VPVPGYTKLPEPCPSTVTPGPAQQKTKQK                                             141 - 169
//

Text Mined References (38)

PMID Year Title