1. Home
  2. Targets
  3. Small proline-rich protein 3

Tbio Small proline-rich protein 3

Cross-linked envelope protein of keratinocytes.

 Comments

Property Summary

NCBI Gene PubMed Count 35
PubMed Score 50.12
PubTator Score 27.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.14559209599091E-123
non-small cell lung cancer 2798 2.53596382430992E-10
cystic fibrosis 1670 7.14819013076501E-5
nasopharyngeal carcinoma 1056 1.23682695239803E-4
colon cancer 1475 0.00265220578208219
cutaneous lupus erythematosus 1056 0.00331286070988516
pancreatic cancer 2300 0.00404327630720641
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00846714392548078
lung cancer 4473 0.0180384956613596
esophageal adenocarcinoma 737 0.0238405656794597

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -4.400 0.024
psoriasis 7.000 0.000
cutaneous lupus erythematosus 3.500 0.003
non-small cell lung cancer 4.362 0.000
intraductal papillary-mucinous neoplasm ... 2.100 0.008
colon cancer 1.400 0.003
pancreatic cancer 2.300 0.004
lung cancer -4.900 0.018
cystic fibrosis 4.700 0.000
nasopharyngeal carcinoma -3.400 0.000

Synonym

Accession Q9UBC9 A5YKK8 B2R4G8 D3DV32 O75597 Q4ZGI7 Q5T525 Q8NET7 Q9UDG3
Symbols

Gene

SPRR3

  Ortholog (1)

Species Source
Chimp OMA EggNOG

 GO Function (1)

 GO Component (3)

 GO Process (5)

 Compartment GO Term (19)

See all...

 IMPC Term (1)

 MGI Term (5)

 HCA RNA Cell Line (19)

See all...

Pathway (4)

 UniProt Keyword (8)

Gene RIF (12)

PMID Text
23820115 Results implicate that SPRR3 might serve as a radiation-sensitive predictor of ESCC.
22076481 This study demonstrates that SPRR3 promotes BC cell proliferation by enhancing p53 degradation via the AKT and MAPK pathways
21777580 The quantitative analysis of SPRR3 mRNA is a robust and reliable method to monitor the malignant transformation of the healthy esophageal mucosa into esophageal squamous cell carcinoma.
21490620 The SPRR3 variant associated with eczema carried an extra 24-bp repeat in the central domain, which may alter the physical properties of the cornified cell envelope
20599699 two isoforms of SPRR3 were characterized from saliva of preterm human newborn and autoptic fetal oral mucosa, parotid and submandibular gland samples.
20379613 Results suggest that increased expression of SPRR3 is involved in colorectal tumorigenesis.
19211270 Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points.
18832573 These data suggest that SPRR3 may play a role in vascular smooth muscle cells adaptation to local biomechanical stress within the plaque microenvironment.
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
17935133 Esophagin/SPRR3 may play a role in the maintenance of normal esophageal epithelial homeostasis, and aberrant expression of Esophagin/SPRR3 may contribute to the tumorigenesis of esophageal squamous cell carcinoma
More...

AA Sequence 

MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP      1 - 70
EPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTK     71 - 140
VPVPGYTKLPEPCPSTVTPGPAQQKTKQK                                             141 - 169
//

Text Mined References (37)

PMID Year Title
23820115 2013 Small proline-rich repeat protein 3 enhances the sensitivity of esophageal cancer cells in response to DNA damage-induced apoptosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22076481 2012 Expression of SPRR3 is associated with tumor cell proliferation in less advanced stages of breast cancer.
21777580 2011 Quantitative evaluation of SPRR3 expression in esophageal squamous cell carcinoma by qPCR and its potential use as a biomarker.
21490620 2011 Association screening in the Epidermal Differentiation Complex (EDC) identifies an SPRR3 repeat number variant as a risk factor for eczema.
20599699 2010 Characterization of two isoforms of human SPRR3 from saliva of preterm human newborn and autoptic fetal oral mucosa, parotid and submandibular gland samples.
20379613 Upregulation of SPRR3 promotes colorectal tumorigenesis.
19211270 Biomechanical stress induces novel arterial intima-enriched genes: implications for vascular adaptation to stress.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...