Property Summary

NCBI Gene PubMed Count 11
PubMed Score 451.96
PubTator Score 316.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (8)

AA Sequence

MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWK      1 - 70
AIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS                             71 - 116
//

Text Mined References (11)

PMID Year Title