Property Summary

NCBI Gene PubMed Count 10
Grant Count 39
R01 Count 17
Funding $4,578,777.23
PubMed Score 420.99
PubTator Score 316.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (7)

PMID Text
23537644 One isoform (alarin) of this gene but not the other (galanin-like peptide) displays antimicrobial activity against E. coli.
20574532 Observational study of gene-disease association. (HuGE Navigator)
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
17535903 reports immunostaining of human GALP in the dermal microvasculature.
16787232 This review presents considerable evidence that has accumulated implicating both galanin and GALP as playing important roles in regulating food and water intake behavior and related neuroendocrine functions.
11861493 describes the gene structure of human GALP.
10601261 describes cloning of the full-length human GALP

AA Sequence

MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWK      1 - 70
AIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS                             71 - 116
//

Text Mined References (10)

PMID Year Title
23537644 2013 Alarin but not its alternative-splicing form, GALP (Galanin-like peptide) has antimicrobial activity.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
18830724 2009 Assessment of Alzheimer's disease case-control associations using family-based methods.
17604107 2007 The galanin peptide family: receptor pharmacology, pleiotropic biological actions, and implications in health and disease.
17535903 2007 Alarin is a vasoactive peptide.
16954604 2006 Gangliocytes in neuroblastic tumors express alarin, a novel peptide derived by differential splicing of the galanin-like peptide gene.
16787232 2006 Galanin/GALP receptors and CNS homeostatic processes.
12007540 2002 Galanin/GALP and galanin receptors: role in central control of feeding, body weight/obesity and reproduction?
11861493 2002 Cloning and distribution of galanin-like peptide mRNA in the hypothalamus and pituitary of the macaque.
10601261 1999 Isolation and cDNA cloning of a novel galanin-like peptide (GALP) from porcine hypothalamus.