Property Summary

Ligand Count 11
NCBI Gene PubMed Count 316
PubMed Score 480.90
PubTator Score 460.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 5.16 2.6

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 3.7e-05
group 3 medulloblastoma 1.200 5.9e-04
invasive ductal carcinoma 1.200 1.3e-02
lung adenocarcinoma 1.300 3.8e-05
malignant mesothelioma 1.900 6.1e-08
medulloblastoma, large-cell 1.400 2.2e-03
non-small cell lung cancer 1.035 3.1e-09
ovarian cancer 1.200 2.7e-06
primitive neuroectodermal tumor 2.100 1.4e-02

Gene RIF (308)

AA Sequence

MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL      1 - 70
TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF     71 - 140
PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG    141 - 210
DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL    211 - 280
GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP    281 - 350
NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM    351 - 420
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC    421 - 490
SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA    491 - 560
PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN    561 - 630
ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV    631 - 700
AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK    701 - 770
VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR    771 - 840
HLFAPLKDYFACE                                                             841 - 853
//

Text Mined References (323)

PMID Year Title