Property Summary

NCBI Gene PubMed Count 272
Grant Count 145
R01 Count 83
Funding $17,671,603.31
PubMed Score 437.71
PubTator Score 460.37

Knowledge Summary

Patent

No data available

Expression

Gene

PDB

3FLG   3QKJ   5CIU  

Gene RIF (267)

PMID Text
27062459 Increasing DNA methylation in the gene-coding area of DNMT3B was associated with higher risk of colorectal adenomas (OR = 1.34; 95% CI: 1.01-1.79 per SD).
26892683 Data indicate an epigenetic prognostic signature in glioblastomas based on expression of polycomb repressive complex 2 (EZH2), DNA-methyltransferases DNMT1 and 3B which can be used easily in routine neuropathology practice.
26729896 Deregulated Dnmt3b targets have prognostic impact in acute myeloid leukemia patients.
26667181 Downregulation of DNMT3B, one of the targets identified using this method, radiosensitizes cancer cells by disturbing multiple DNA damage responses.
26629529 Our results demonstrate DNMT3B4-del as a critical factor in developing aberrant DNA methylation patterns during lung tumorigenesis and suggest that DNMT3B4-del may be a target for lung cancer prevention.
26573490 The HBVX gene upregulated the mRNA and protein expression levels of DNMT3A/3B, downregulated the expression of SOCS1 and increased SOCS1 gene promoter CpG island methylation.
26556862 Data show that microRNA miR-221 contributes to breast cancer tumorigenicity by regulating stemness, at least in part through the control of DNA methyltransferase 3B (DNMT3b) expression.
26505438 Results suggested that the DNMT3B -149C/T polymorphism is associated with a genetic susceptibility for developing LSCC in a Chinese population.
26497367 miR-124 and miR-506 inhibit progression and increase sensitivity to chemotherapy by targeting DNMT3B and DNMT1 in colorectal carcinoma.
26485042 For DNMT3B, increasing DNA methylation of CpG sites in the gene-coding area was associated with a higher risk of colorectal adenomas.
More...

AA Sequence

MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL      1 - 70
TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF     71 - 140
PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG    141 - 210
DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL    211 - 280
GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP    281 - 350
NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM    351 - 420
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC    421 - 490
SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA    491 - 560
PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN    561 - 630
ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV    631 - 700
AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK    701 - 770
VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR    771 - 840
HLFAPLKDYFACE                                                             841 - 853
//

Text Mined References (277)

PMID Year Title
27062459 2016 Genetic and epigenetic variation in the DNMT3B and MTHFR genes and colorectal adenoma risk.
26892683 2016 Expression of DNA methyltransferases 1 and 3B correlates with EZH2 and this 3-marker epigenetic signature predicts outcome in glioblastomas.
26729896 2016 Increased DNA methylation of Dnmt3b targets impairs leukemogenesis.
26667181 2015 A comprehensive analysis of radiosensitization targets; functional inhibition of DNA methyltransferase 3B radiosensitizes by disrupting DNA damage regulation.
26629529 2015 ? DNMT3B4-del Contributes to Aberrant DNA Methylation Patterns in Lung Tumorigenesis.
26573490 2016 Hepatitis B virus X protein upregulates DNA methyltransferase 3A/3B and enhances SOCS-1CpG island methylation.
26556862 2016 MiR-221 promotes stemness of breast cancer cells by targeting DNMT3b.
26505438 2015 DNA methyltransferase 3B -149C/T polymorphism and the risk of laryngeal squamous cell carcinoma: a case-control study.
26497367 2015 miR-124 and miR-506 inhibit colorectal cancer progression by targeting DNMT3B and DNMT1.
26485042 2015 Gene-specific DNA methylation of DNMT3B and MTHFR and colorectal adenoma risk.
More...