Property Summary

NCBI Gene PubMed Count 50
PubMed Score 29.26
PubTator Score 42.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Amelogenesis imperfecta type 1E 3 3.069 1.5
Disease Target Count
Rheumatoid arthritis 1191

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.5e-02

Gene RIF (45)

AA Sequence

MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLH      1 - 70
RACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQ     71 - 140
ILGWGPPWDSAEEEEEDDASKEREWRQKLQGELEDEWQEVMGRFEGDASHETQEPESFSAWSDRLAREHA    141 - 210
QKCQQQQREAEGSCRPPRAEGSSQSWRQQEEEQRLFRERARAKEEELRESRARRAQEALGDREPKPTRAG    211 - 280
PREEHPRGAGRGSLWRFGDVPWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRF    281 - 350
RSQIETWELGRVMGAVTALSQALNRHAEALK                                           351 - 381
//

Text Mined References (53)

PMID Year Title