Property Summary

NCBI Gene PubMed Count 50
PubMed Score 28.22
PubTator Score 42.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 0.0145203546211429
Disease Target Count
Rheumatoid Arthritis 1171

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.015

Synonym

Accession Q9UBC1 A6NL91 B4DUW1 Q14625 Q5HYU4 Q5RJ72 Q5ST96 Q5STV4 Q5STV5 Q9UBX4
Symbols IKBL
LST1
NFKBIL

Gene

  Ortholog (9)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (45)

PMID Text
25809685 genetic association studies in a population of black women in South Africa: Data suggest that an SNP in NFKBIL1 (rs2071592) is associated with iron status/iron-deficiency anemia in the population studied.
23953137 These observations suggest a functional involvement of IkappaBL in the regulation of alternative splicing in both human and viral genes, which is a novel link of HLA locus to the regulation of immunity and infection in humans.
22210660 an association was noted between IKBL-62T and idiopathic inflammatory myopathy, with increased risk noted in anti-Jo-1- and -PM-Scl antibody-positive patients; the IKBL-62T association is dependent on TNF-308A and HLA-B*08, due to strong shared linkage disequilibrium between these alleles
20933106 Observational study of gene-disease association. (HuGE Navigator)
20854863 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20568399 Results of the present study do not provide evidence for the association between the NFKBIL1 exon 4 polymorphism and MS predisposition in the investigated Polish population.
20568399 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLH      1 - 70
RACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQ     71 - 140
ILGWGPPWDSAEEEEEDDASKEREWRQKLQGELEDEWQEVMGRFEGDASHETQEPESFSAWSDRLAREHA    141 - 210
QKCQQQQREAEGSCRPPRAEGSSQSWRQQEEEQRLFRERARAKEEELRESRARRAQEALGDREPKPTRAG    211 - 280
PREEHPRGAGRGSLWRFGDVPWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRF    281 - 350
RSQIETWELGRVMGAVTALSQALNRHAEALK                                           351 - 381
//

Text Mined References (53)

PMID Year Title
25809685 2015 Common Variants and Haplotypes in the TF, TNF-?, and TMPRSS6 Genes Are Associated with Iron Status in a Female Black South African Population.
23953137 2013 A novel link of HLA locus to the regulation of immunity and infection: NFKBIL1 regulates alternative splicing of human immune-related genes and influenza virus M gene.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22210660 2012 Genetic association study of NF-?B genes in UK Caucasian adult and juvenile onset idiopathic inflammatory myopathy.
20933106 2011 Autoimmune hepatitis, HLA and extended haplotypes.
20854863 2010 Characterization of tumor necrosis factor-? block haplotypes associated with susceptibility to chronic venous leg ulcers in Caucasian patients.
20829348 2010 Cactin targets the MHC class III protein IkappaB-like (IkappaBL) and inhibits NF-kappaB and interferon-regulatory factor signaling pathways.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
More...