Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.48
PubTator Score 6.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.600 9.0e-08
astrocytic glioma -2.400 1.2e-03
Astrocytoma, Pilocytic -1.900 4.1e-10
atypical teratoid / rhabdoid tumor -2.400 5.5e-09
ependymoma -2.700 8.9e-04
glioblastoma -2.500 9.9e-11
group 3 medulloblastoma -2.500 4.2e-07
invasive ductal carcinoma 1.200 7.7e-03
medulloblastoma, large-cell -2.500 1.7e-05
oligodendroglioma -1.900 3.8e-02
Pick disease -2.300 8.2e-04
pituitary cancer 1.300 2.3e-05
primitive neuroectodermal tumor -2.100 7.1e-05

Gene RIF (5)

AA Sequence

MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDSEQFAALLLVTKAVKAGDIDA      1 - 70
KTRRRIFDAVGFTFPNRLLTTKEAPDGCPDHVLRALGVALLACFCSDPELAAHPQVLNKIPILSTFLTAR     71 - 140
GDPDDAARRSMIDDTYQCLTAVAGTPRGPRHLIAGGTVSALCQAYLGHGYGFDQALALLVGLLAAAETQC    141 - 210
WKEAEPDLLAVLRGLSEDFQKAEDASKFELCQLLPLFLPPTTVPPECYRDLQAGLARILGSKLSSWQRNP    211 - 280
ALKLAARLAHACGSDWIPAGSSGSKFLALLVNLACVEVRLALEETGTEVKEDVVTACYALMELGIQECTR    281 - 350
CEQSLLKEPQKVQLVSVMKEAIGAVIHYLLQVGSEKQKEPFVFASVRILGAWLAEETSSLRKEVCQLLPF    351 - 420
LVRYAKTLYEEAEEANDLSQQVANLAISPTTPGPTWPGDALRLLLPGWCHLTVEDGPREILIKEGAPSLL    421 - 490
CKYFLQQWELTSPGHDTSVLPDSVEIGLQTCCHIFLNLVVTAPGLIKRDACFTSLMNTLMTSLPALVQQQ    491 - 560
GRLLLAANVATLGLLMARLLSTSPALQGTPASRGFFAAAILFLSQSHVARATPGSDQAVLALSPEYEGIW    561 - 630
ADLQELWFLGMQAFTGCVPLLPWLAPAALRSRWPQELLQLLGSVSPNSVKPEMVAAYQGVLVELARANRL    631 - 700
CREAMRLQAGEETASHYRMAALEQCLSEP                                             701 - 729
//

Text Mined References (23)

PMID Year Title