Property Summary

NCBI Gene PubMed Count 91
Grant Count 100
R01 Count 57
Funding $8,522,129.45
PubMed Score 45.16
PubTator Score 193.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UBB5 O95242 Q9UIS8
Symbols DMTase
NY-CO-41

Gene

PDB

2L2L  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
686964 screening 1149 / 0 / 369127 TRFRET-based biochemical primary high throughput screening assay to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide
686973 summary 0 / 0 / 0 Summary of a probe development effort to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide
720531 screening 271 / 0 / 765 TRFRET-based biochemical high throughput confirmation assay to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide
720645 confirmatory 17 / 0 / 29 TRFRET-based biochemical high throughput dose response assay to identify inhibitors of 5-meCpG-binding domain protein 2 (MBD2)-DBD binding to methylated oligonucleotide

Gene RIF (68)

PMID Text
26827827 Specifically, methyl-CpG-binding domain protein 2 (MBD2) is revealed to be recruited to DNA damage sites after laser microirradiation, which was mediated through MBD domain and MBD2 C-terminus.
26788506 downregulation of miR-221 inhibits cell migration and invasion at least partially through targeting MBD2 in the human OSCC cell line UM1.
26007656 The dynamics of MBD2 deposition across methylated DNA regions was associated with the oncogenic transformation of human mammary cells.
25798578 MBD2 targets short interspersed nuclear elements, but does not exclude RNA Polymerase III.
25753662 Biophysical analyses show that the MBD2IDR is an intrinsically disordered region (IDR). However, despite this inherent disorder, MBD2IDR increases the overall binding affinity of MBD2 for methylated DNA.
25178277 These data point to a potential new approach in targeting the DNA methylation machinery by combination of MBD2 and DNMT inhibitors.
25135974 The methylated-DNA binding protein MBD2 enhances NGFI-A (egr-1)-mediated transcriptional activation of the glucocorticoid receptor.
24927503 Data suggest that MBD2 binds primarily at highly methylated regions, with a strong preference for CpG islands and highlights that MBD2 binding sites display increased methylation in primary breast cancer tissues as compared to normal mammary cells.
24849540 This study investigates the genetic association between methyl-CpG-binding domain (MBD) gene polymorphisms and schizophrenia.
24813856 alternatively spliced isoforms support pluripotency of stem cells
More...

AA Sequence

MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRG      1 - 70
GGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRG     71 - 140
PRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRT    141 - 210
GKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQ    211 - 280
LFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAV    281 - 350
WLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA             351 - 411
//

Text Mined References (98)

PMID Year Title
26827827 2016 iTRAQ-based chromatin proteomic screen reveals CHD4-dependent recruitment of MBD2 to sites of DNA damage.
26788506 2015 Downregulation of miR-221 Inhibits Cell Migration and Invasion through Targeting Methyl-CpG Binding Domain Protein 2 in Human Oral Squamous Cell Carcinoma Cells.
26007656 2015 Dynamics of MBD2 deposition across methylated DNA regions during malignant transformation of human mammary epithelial cells.
25798578 2015 SINE transcription by RNA polymerase III is suppressed by histone methylation but not by DNA methylation.
25753662 2015 An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex.
25178277 2014 Synergistic effects of combined DNA methyltransferase inhibition and MBD2 depletion on breast cancer cells; MBD2 depletion blocks 5-aza-2'-deoxycytidine-triggered invasiveness.
25135974 2014 The methylated-DNA binding protein MBD2 enhances NGFI-A (egr-1)-mediated transcriptional activation of the glucocorticoid receptor.
24927503 2014 Genome-wide binding of MBD2 reveals strong preference for highly methylated loci.
24849540 2014 Genetic association study between methyl-CpG-binding domain genes and schizophrenia among Chinese family trios.
24813856 2014 Alternative splicing of MBD2 supports self-renewal in human pluripotent stem cells.
More...