Property Summary

Ligand Count 4
NCBI Gene PubMed Count 98
PubMed Score 47.72
PubTator Score 193.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.4e-05
atypical teratoid / rhabdoid tumor 1.800 4.7e-05
glioblastoma 1.600 3.3e-03
group 3 medulloblastoma 1.600 2.4e-03
juvenile dermatomyositis 1.212 6.3e-12
lung cancer -1.200 1.6e-02
medulloblastoma, large-cell 1.100 1.5e-04
ovarian cancer -2.200 1.6e-08
pediatric high grade glioma 1.100 4.9e-04
posterior fossa group A ependymoma 1.100 1.1e-05
primitive neuroectodermal tumor 1.700 7.0e-03
spina bifida -1.086 2.8e-02
subependymal giant cell astrocytoma 1.592 1.4e-02

Gene RIF (72)

AA Sequence

MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRG      1 - 70
GGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRG     71 - 140
PRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRT    141 - 210
GKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQ    211 - 280
LFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAV    281 - 350
WLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA             351 - 411
//

Text Mined References (106)

PMID Year Title