Property Summary

NCBI Gene PubMed Count 45
PubMed Score 67.25
PubTator Score 59.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.100 2.9e-03
intraductal papillary-mucinous adenoma (... -1.200 3.4e-04
intraductal papillary-mucinous neoplasm ... -1.300 9.4e-03
lung cancer 1.200 3.7e-03
Multiple myeloma 1.348 7.5e-03
ovarian cancer -1.500 5.7e-11
tuberculosis 1.200 3.7e-05

Gene RIF (25)

AA Sequence

MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQ      1 - 70
VENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIGVAVDLILLFRELRVEQESLLTAFRCGLQFLG     71 - 140
NIASRNEDSQSIVWVHAFPELFLSCLNHPDKKIVAYSSMILFTSLNHERMKELEENLNIAIDVIDAYQKH    141 - 210
PESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTFV    211 - 280
DQCKTVLKLASEEPPDDEEALATIRLLDVLCEMTVNTELLGYLQVFPGLLERVIDLLRVIHVAGKETTNI    281 - 350
FSNCGCVRAEGDISNVANGFKSHLIRLIGNLCYKNKDNQDKVNELDGIPLILDNCNISDSNPFLTQWVIY    351 - 420
AIRNLTEDNSQNQDLIAKMEEQGLADASLLKKVGFEVEKKGEKLILKSTRDTPKP                   421 - 475
//

Text Mined References (48)

PMID Year Title