Property Summary

NCBI Gene PubMed Count 43
Grant Count 14
R01 Count 12
Funding $1,318,780.09
PubMed Score 57.94
PubTator Score 59.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.348 0.007
tuberculosis 1.200 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.009
lung cancer 1.200 0.004
breast carcinoma 1.100 0.003
ovarian cancer -1.900 0.000

Gene RIF (23)

PMID Text
26295943 Single molecule real time sequencing of long tandem nucleotide repeats in spinocerebellar ataxia ATXN10 reveals unique insight of repeat expansion structure in three unrelated patients.
26039897 Data suggest precursor mRNA for SCA10 (crystalized using two model AUUCU SCA10 repeats) exhibits the following conformation: the two asymmetric RNA molecules are antiparallel to each other and the interaction is stabilized by multiple hydrogen bonds.
25666058 Inhibition of Aurora B or expression of the S12A mutant renders reduced interaction between Ataxin-10 and polo-like kinase 1 (Plk1), a kinase previously identified to regulate Ataxin-10 in cytokinesis.
25630585 This is the first description of a family with two SCA mutations with affected subjects having a combined SCA2 and SCA10 phenotype.
24318420 the presence of repeat interruptions in SCA10 repeat expansion may have a role in epilepsy phenotype
23026538 The SCA10 pentanucleotide repeat expansion was not found among a group of Cypriot ataxia patients. All had 10-19 ATTCT repeats. Controls had 11-20 repeats, with 14 being the most common number.
22190034 HIV-1 Vpu is identified to have a physical interaction with ataxin 10 (ATXN10) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21857149 Plk1 phosphorylates Ataxin-10 on Ser 77 and Thr 82.
21827910 The expansion of the attct repeat in intron 9 of atxn10 is may caused Spinocerebellar ataxia type 10.
21565611 Network building strategy led to the proposal of candidates for new ciliopathy disease genes, leading to the identification of the first human mutations in the Nephronophthisis gene Ataxin10 (ATXN10) and Joubert syndrome gene Tectonic2 (TCTN2).
More...

AA Sequence

MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQ      1 - 70
VENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIGVAVDLILLFRELRVEQESLLTAFRCGLQFLG     71 - 140
NIASRNEDSQSIVWVHAFPELFLSCLNHPDKKIVAYSSMILFTSLNHERMKELEENLNIAIDVIDAYQKH    141 - 210
PESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTFV    211 - 280
DQCKTVLKLASEEPPDDEEALATIRLLDVLCEMTVNTELLGYLQVFPGLLERVIDLLRVIHVAGKETTNI    281 - 350
FSNCGCVRAEGDISNVANGFKSHLIRLIGNLCYKNKDNQDKVNELDGIPLILDNCNISDSNPFLTQWVIY    351 - 420
AIRNLTEDNSQNQDLIAKMEEQGLADASLLKKVGFEVEKKGEKLILKSTRDTPKP                   421 - 475
//

Text Mined References (46)

PMID Year Title
26295943 2015 SMRT Sequencing of Long Tandem Nucleotide Repeats in SCA10 Reveals Unique Insight of Repeat Expansion Structure.
26039897 2015 Crystallographic and Computational Analyses of AUUCU Repeating RNA That Causes Spinocerebellar Ataxia Type 10 (SCA10).
26002199 2015 The Repeat Expansion Diseases: The dark side of DNA repair.
25666058 2015 Aurora B-dependent phosphorylation of Ataxin-10 promotes the interaction between Ataxin-10 and Plk1 in cytokinesis.
25630585 2015 Bolivian kindred with combined spinocerebellar ataxia types 2 and 10.
24318420 2014 Repeat interruptions in spinocerebellar ataxia type 10 expansions are strongly associated with epileptic seizures.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23026538 2012 Investigation of SCA10 in the Cypriot population: further exclusion of SCA dynamic repeat mutations.
More...