Property Summary

NCBI Gene PubMed Count 2,525
PubMed Score 0.00
PubTator Score 5085.80

Knowledge Summary

Patent

No data available

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (2749)

AA Sequence

MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFD      1 - 70
SDVGEYRAVTELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQH     71 - 140
HNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVM    141 - 210
SPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS                  211 - 266
//

Text Mined References (2530)

PMID Year Title