Property Summary

NCBI Gene PubMed Count 755
PubMed Score 777.37
PubTator Score 146.73

Knowledge Summary

Patent

No data available

Synonym

Accession Q9TNN7 O02866 O62888 Q9TPV8 Q9TPX2
Symbols MHC
HLAC
HLC-C
D6S204
PSORS1
HLA-JY3

Gene

 GO Function (1)

Gene RIF (831)

PMID Text
26828202 HLA-C expressed on HIV-infected cells restricts attack by KIR2DL(+) CD56(dim) natural killer (NK) cells
26613595 four amino-acid positions of HLA-B and -C account for most of the associations between ankylosing spondylitis and MHC in the Korean population
26600554 Therefore, the results obtained in this study demonstrate the involvement of HLA class I genes in the susceptibility or resistance to American cutaneous leishmaniasis (ACL), with significant association between HLA-C*04 and ACL susceptibility.
26589762 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency
26542067 gene polymorphism is associated with Crohn's disease in Spanish patients
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26470763 HLA-C genetic polymorphism is associated with psoriasis.
26416275 Data suggest regulatory interactions between major histocompatibility antigen HLA-C and killer cell Ig-like receptor (KIR) might promote Graft-versus-Leukemia effects following transplantation.
26383988 HLA-C2 and -C1, showed highly significant associations with CRC development.
26372271 The authors have identified a deleterious effect of the KIR2DL3-HLA-C1 receptor-ligand combination on HIV clinical outcomes in a Thai cohort.
More...

AA Sequence

MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE      1 - 70
PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQF     71 - 140
AYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPK    141 - 210
THVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGGKGGSCSQAAS    281 - 350
SNSAQGSDESLIACKA                                                          351 - 366
//

Text Mined References (757)

PMID Year Title
26828202 2016 A Conserved HIV-1-Derived Peptide Presented by HLA-E Renders Infected T-cells Highly Susceptible to Attack by NKG2A/CD94-Bearing Natural Killer Cells.
26613595 2015 An HLA-C amino-acid variant in addition to HLA-B*27 confers risk for ankylosing spondylitis in the Korean population.
26600554 2015 Association between HLA-C*04 and American cutaneous leishmaniasis in endemic region of southern Brazil.
26589762 2016 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency.
26542067 2016 Significant association of the KIR2DL3/HLA-C1 genotype with susceptibility to Crohn's disease.
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26470763 2016 HLA-C and TNF gene polymorphisms are associated with psoriasis in Brazilian patients.
26416275 2015 Regulation of Adaptive NK Cells and CD8 T Cells by HLA-C Correlates with Allogeneic Hematopoietic Cell Transplantation and with Cytomegalovirus Reactivation.
26383988 2015 The Relationship Between Killer Cell Immunoglobulin-Like Receptors and HLA-C Polymorphisms in Colorectal Cancer in a Saudi Population.
26372271 2015 The effect of KIR2D-HLA-C receptor-ligand interactions on clinical outcome in a HIV-1 CRF01_AE-infected Thai population.
More...