Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.45
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pituitary cancer 1972 3.70615215066236E-6
interstitial cystitis 2299 3.24513601995584E-5
atypical teratoid / rhabdoid tumor 4369 8.77546250450928E-5
medulloblastoma, large-cell 6234 1.49903379454864E-4
adrenocortical carcinoma 1427 0.00655652630092109
subependymal giant cell astrocytoma 2287 0.0196724559779975
gastric carcinoma 832 0.0385250336236906
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0469349580072216

Expression

Synonym

Accession Q9P2Z0 B2R8R0
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid

Gene RIF (1)

PMID Text
18575747 transcripts of LRRC49/THAP10 bidirectional gene pair are co-regulated by estrogen and that hypermethylation of the bidirectional promoter region simultaneously silences both genes.

AA Sequence

MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAPACFDVSSVIQ      1 - 70
KNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAARHSEAAPGPVSCTRPRAGKQAA     71 - 140
ASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATT    141 - 210
QTEELWSRTSSLFDIYSSDSETDTDWDIKSEQSDLSYMAVQVKEETC                           211 - 257
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18575747 2008 Silencing of LRRC49 and THAP10 genes by bidirectional promoter hypermethylation is a frequent event in breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12575992 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.