Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.95
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9P2Z0 B2R8R0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAPACFDVSSVIQ      1 - 70
KNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAARHSEAAPGPVSCTRPRAGKQAA     71 - 140
ASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATT    141 - 210
QTEELWSRTSSLFDIYSSDSETDTDWDIKSEQSDLSYMAVQVKEETC                           211 - 257
//

Text Mined References (9)

PMID Year Title