Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.45
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18575747 transcripts of LRRC49/THAP10 bidirectional gene pair are co-regulated by estrogen and that hypermethylation of the bidirectional promoter region simultaneously silences both genes.

AA Sequence

MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAPACFDVSSVIQ      1 - 70
KNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAARHSEAAPGPVSCTRPRAGKQAA     71 - 140
ASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATT    141 - 210
QTEELWSRTSSLFDIYSSDSETDTDWDIKSEQSDLSYMAVQVKEETC                           211 - 257
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18575747 2008 Silencing of LRRC49 and THAP10 genes by bidirectional promoter hypermethylation is a frequent event in breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12575992 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.