Property Summary

NCBI Gene PubMed Count 49
Grant Count 48
R01 Count 35
Funding $3,401,740.08
PubMed Score 45.85
PubTator Score 42.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.867 0.000
tuberculosis and treatment for 6 months 1.200 0.000
dermatomyositis 1.400 0.001

 GO Function (1)

Gene RIF (24)

PMID Text
26717041 Under-expression of UVRAG is associated with colorectal cancer.
26234763 UVRAG frameshift is expressed as a truncated protein in colorectal cancer with microsatellite instability and promotes tumorigenesis. UVRAG(FS) expression renders cells more sensitive to standard chemotherapy regimen due to a DNA repair defect.
26139536 tubulation requires mTOR activity, and we identified two direct mTOR phosphorylation sites on UVRAG (S550 and S571) that activate VPS34.
25807108 HCV, by differentially inducing the expression of Rubicon and UVRAG, temporally regulated the autophagic flux to enhance its replication.
25533187 Dephosphorylation of UVRAG facilitates the lysosomal degradation of epidermal growth factor receptor (EGFR), reduces EGFR signaling, and suppresses cancer cell proliferation and tumor growth.
24956373 Beclin 1 and UVRAG confer protection against radiation-induced DNA DNA double strand breaks and may maintain centrosome stability in established tumor cells.
24882360 The reports that Grb2, when in excess, interacts with ultraviolet radiation resistance-associated gene protein (UVRAG) under excess conditions of AICD-Grb2 or Grb2.
24550300 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
23200933 Akt1 may inhibit autophagy by decreasing UVRAG expression, which also sensitizes cancer cells to UV irradiation.
22542840 UVRAG promotes DNA double-strand-break repair by directly binding and activating DNA-PK in nonhomologous end joining. Disruption of UVRAG increases genetic instability and sensitivity of cells to irradiation.
More...

AA Sequence

MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHL      1 - 70
CSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKENIYQLLIEWKVCLDGLKY     71 - 140
LGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQ    141 - 210
VTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFS    211 - 280
AEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSE    281 - 350
DFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKL    351 - 420
QFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADV    421 - 490
GFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKE    491 - 560
NKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASVQLPGEFHPVSEAELCCTVE    561 - 630
QAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK     631 - 699
//

Text Mined References (60)

PMID Year Title
26717041 2016 miR-183 regulates autophagy and apoptosis in colorectal cancer through targeting of UVRAG.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26234763 2015 Truncating mutation in the autophagy gene UVRAG confers oncogenic properties and chemosensitivity in colorectal cancers.
26139536 2015 mTOR activates the VPS34-UVRAG complex to regulate autolysosomal tubulation and cell survival.
25807108 2015 HCV induces the expression of Rubicon and UVRAG to temporally regulate the maturation of autophagosomes and viral replication.
25533187 2015 mTORC1 phosphorylates UVRAG to negatively regulate autophagosome and endosome maturation.
25490155 2014 Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex.
24956373 2014 Beclin 1 and UVRAG confer protection from radiation-induced DNA damage and maintain centrosome stability in colorectal cancer cells.
24882360 2014 Interaction of Grb2 SH3 domain with UVRAG in an Alzheimer's disease-like scenario.
24849286 2014 NRBF2 regulates autophagy and prevents liver injury by modulating Atg14L-linked phosphatidylinositol-3 kinase III activity.
More...