Property Summary

NCBI Gene PubMed Count 54
PubMed Score 50.18
PubTator Score 42.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis and treatment for 6 months 409 8.4e-06
osteosarcoma 7950 3.3e-05
dermatomyositis 966 5.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 3.131 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
dermatomyositis 1.400 5.8e-04
osteosarcoma -1.867 3.3e-05
tuberculosis and treatment for 6 months 1.200 8.4e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (28)

AA Sequence

MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHL      1 - 70
CSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKENIYQLLIEWKVCLDGLKY     71 - 140
LGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQ    141 - 210
VTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFS    211 - 280
AEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSE    281 - 350
DFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKL    351 - 420
QFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADV    421 - 490
GFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKE    491 - 560
NKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASVQLPGEFHPVSEAELCCTVE    561 - 630
QAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK     631 - 699
//

Text Mined References (64)

PMID Year Title