Property Summary

NCBI Gene PubMed Count 15
Grant Count 42
R01 Count 20
Funding $12,580,991.23
PubMed Score 6.20
PubTator Score 253.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26340669 decreases of CES and CYP3A4 expression and enzymatic activities induced by Fluoxetine are through decreasing PXR and increasing DEC1 in HepG2 cells
20975315 DEC1 is down-regulated and tends to contribute to the migration ability of tumor cell lines; H3 K27 trimethylation potentially plays an important role in the regulation of DEC1 expression
20935061 DEC1 promoter -249 T>C (rs2012775) polymorphism is functional, modulating susceptibility to squamous cell carcinoma of the head and neck (SCCHN) among non-Hispanic Whites.
20935061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
17943723 Decreased expression of candidate DEC1 is associated with esophageal carcinoma
15580306 DEC1 is a candidate tumor suppressor gene that may be involved in esophageal squamous cell carcinoma development

AA Sequence

MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD      1 - 70
//

Text Mined References (15)

PMID Year Title
26340669 2016 Fluoxetine reduces CES1, CES2, and CYP3A4 expression through decreasing PXR and increasing DEC1 in HepG2 cells.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23180869 2014 Genome-wide association study of survival in patients with pancreatic adenocarcinoma.
20975315 2011 Deleted in Esophageal Cancer 1(DEC1) is down-regulated and contributes to migration in head and neck squamous cell carcinoma cell lines.
20935061 2010 A novel functional DEC1 promoter polymorphism -249T>C reduces risk of squamous cell carcinoma of the head and neck.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
17943723 2008 Frequent decreased expression of candidate tumor suppressor gene, DEC1, and its anchorage-independent growth properties and impact on global gene expression in esophageal carcinoma.
15580306 2005 Tumor suppressive role of a 2.4 Mb 9q33-q34 critical region and DEC1 in esophageal squamous cell carcinoma.
More...