Property Summary

NCBI Gene PubMed Count 8
PubMed Score 415.73
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
aldosterone-producing adenoma -1.315 3.5e-02
Astrocytoma, Pilocytic 1.100 4.5e-04
ependymoma 1.500 5.5e-12
glioblastoma 1.300 8.6e-06
intraductal papillary-mucinous adenoma (... 1.200 2.7e-02
nasopharyngeal carcinoma 1.400 4.5e-04
non-small cell lung cancer 1.255 1.7e-12
osteosarcoma 1.762 5.4e-04
ovarian cancer -1.200 4.0e-04
pancreatic ductal adenocarcinoma liver m... -1.331 1.9e-02
pediatric high grade glioma 1.500 1.3e-07
primitive neuroectodermal tumor 1.200 7.2e-04
Rheumatoid arthritis 1.100 3.8e-02
tuberculosis 1.200 2.3e-06

 GO Component (2)

Gene RIF (4)

AA Sequence

MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIY      1 - 70
QLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDD     71 - 140
LILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENK    141 - 210
KIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKH    211 - 280
INNCARNILVEKNYTNSPEESSKALGKNKKVRKDKKRNEH                                  281 - 320
//

Text Mined References (14)

PMID Year Title