Property Summary

NCBI Gene PubMed Count 8
Grant Count 54
R01 Count 19
Funding $14,417,521.75
PubMed Score 359.33
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GO Component (2)

Gene RIF (4)

PMID Text
20648630 Data suggest that high expression of protein IMPACT homolog in non-immune cells acts as a protective mechanism against indoleamine 2,3-dioxygenase (IDO)-induced GCN2 activation, making them resistant to the amino acid-deprived environment caused by IDO.
20237496 Observational study of gene-disease association. (HuGE Navigator)
15871461 segmental duplication followed by enhancement of the promoter activity is responsible for the species-specific imprinting of Impact
15752730 It thus seems that lineage-specific enhancement of gene expression rather than the tandem repeat per se played a critical role in the evolution of imprinting of Impact.

AA Sequence

MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIY      1 - 70
QLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDD     71 - 140
LILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENK    141 - 210
KIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKH    211 - 280
INNCARNILVEKNYTNSPEESSKALGKNKKVRKDKKRNEH                                  281 - 320
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20648630 2010 High expression of IMPACT protein promotes resistance to indoleamine 2,3-dioxygenase-induced cell death.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15937339 2005 IMPACT, a protein preferentially expressed in the mouse brain, binds GCN1 and inhibits GCN2 activation.
15871461 2004 An evolutionary scenario for genomic imprinting of Impact lying between nonimprinted neighbors.
15752730 2005 Comparative genomics approach toward critical determinants for the imprinting of an evolutionarily conserved gene Impact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...