Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.50
PubTator Score 12.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.000 0.000
non primary Sjogren syndrome sicca 1.200 0.049
ovarian cancer 1.600 0.002

Synonym

Accession Q9P2X0 Q5SR62 Q5SR63 Q9BXN4 Q9BXN5
Symbols CDG1O

Gene

AA Sequence

MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDA      1 - 70
ARELQSQIQEARADLARRGLRF                                                     71 - 92
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23856421 2013 Congenital disorder of glycosylation due to DPM1 mutations presenting with dystroglycanopathy-type congenital muscular dystrophy.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19576565 2009 Deficiency of Dol-P-Man synthase subunit DPM3 bridges the congenital disorders of glycosylation with the dystroglycanopathies.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16280320 2006 DPM1, the catalytic subunit of dolichol-phosphate mannose synthase, is tethered to and stabilized on the endoplasmic reticulum membrane by DPM3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...