Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
R01 Count 5
Funding $932,775.67
PubMed Score 32.34
PubTator Score 12.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 0.000

Gene RIF (5)

PMID Text
20634891 Observational study of gene-disease association. (HuGE Navigator)
20087401 Observational study of gene-disease association. (HuGE Navigator)
19401338 Suggest that syntaxin 18 has an important role in ER subdomain organization by mediating the fusion of retrograde membrane carriers with the ER membrane.
18722709 Stx18 in involved in growth of human breast cancer cells and may possibly be used as a prognostic marker and a molecular target in the treatment of breast cancer.
16571679 RINT-1 coordinates the localization and function of ZW10 by serving as a link between ZW10 and the SNARE complex comprising syntaxin 18.

AA Sequence

MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHIGKLRDFLLEH      1 - 70
RKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIED     71 - 140
YLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEERPEKILAE    141 - 210
TQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAE    211 - 280
IDSIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS                   281 - 335
//

Text Mined References (19)

PMID Year Title
24842878 2014 SLY1 and Syntaxin 18 specify a distinct pathway for procollagen VII export from the endoplasmic reticulum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23708191 2013 Genome-wide association study of multiple congenital heart disease phenotypes identifies a susceptibility locus for atrial septal defect at chromosome 4p16.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20087401 2010 Association between genes on chromosome 4p16 and non-syndromic oral clefts in four populations.
19401338 2009 Role of syntaxin 18 in the organization of endoplasmic reticulum subdomains.
19369418 2009 Identification of the neuroblastoma-amplified gene product as a component of the syntaxin 18 complex implicated in Golgi-to-endoplasmic reticulum retrograde transport.
18834646 2008 Members of a mammalian SNARE complex interact in the endoplasmic reticulum in vivo and are found in COPI vesicles.
18722709 2008 Effective stimulation of growth in MCF-7 human breast cancer cells by inhibition of syntaxin18 by external guide sequence and ribonuclease P.
16571679 2006 RINT-1 regulates the localization and entry of ZW10 to the syntaxin 18 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15272311 2004 Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15029241 2004 Implication of ZW10 in membrane trafficking between the endoplasmic reticulum and Golgi.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10788491 2000 Syntaxin 18, a SNAP receptor that functions in the endoplasmic reticulum, intermediate compartment, and cis-Golgi vesicle trafficking.