Property Summary

NCBI Gene PubMed Count 17
PubMed Score 32.83
PubTator Score 12.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group A ependymoma 1.100 6.7e-08

Protein-protein Interaction (13)

Gene RIF (6)

AA Sequence

MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHIGKLRDFLLEH      1 - 70
RKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIED     71 - 140
YLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEERPEKILAE    141 - 210
TQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAE    211 - 280
IDSIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS                   281 - 335
//

Text Mined References (20)

PMID Year Title