Property Summary

NCBI Gene PubMed Count 53
PubMed Score 860.18
PubTator Score 1320.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.800 3.1e-04
atypical teratoid / rhabdoid tumor -3.800 1.7e-10
ependymoma -3.500 2.1e-19
gastric carcinoma -1.400 3.4e-02
glioblastoma -1.400 1.0e-05
lung carcinoma 2.100 5.3e-36
medulloblastoma -1.500 1.3e-03
medulloblastoma, large-cell -3.600 1.5e-06
primitive neuroectodermal tumor -2.300 2.3e-03
subependymal giant cell astrocytoma -2.793 7.9e-03

Gene RIF (48)

AA Sequence

MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTE      1 - 70
YVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDTGLN     71 - 140
YTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSSQPGVVYFADDDNTYSLELFEEMRS    141 - 210
TRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKG    211 - 280
GYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI                    281 - 334
//

Text Mined References (56)

PMID Year Title