Property Summary

NCBI Gene PubMed Count 49
Grant Count 80
R01 Count 37
Funding $7,709,170.94
PubMed Score 838.35
PubTator Score 1320.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P2W7 B7Z5Z8 Q96FS7
Symbols NK1
CD57
HNK1
LEU7
NK-1
GLCATP
GLCUATP

Gene

PANTHER Protein Class (2)

PDB

1V82   1V83   1V84  

Gene RIF (44)

PMID Text
26277688 Among CD8+ T-lymphocytes, CD28+CD57+ cells represent a subset with some senescent features that are distinct from the CD28-CD57+ cells.
26013700 Case Report: chronic lymphocytic leukemia with aberrant CD56 and CD57 expression.
25931385 The frequency of CD57-expressing antigen specific CD4+ T cells was higher in active compared to latent tuberculosis.
25426558 glioblastoma stem cells are killed by CD133-specific CAR T cells but induce the T cell aging marker CD57
25275081 Our results suggest that an increase in the population of CD57(+) T-cells is a potent prognostic marker and may also influence the systemic immunity of patients with OSCC.
24977150 analysis of CD57 in prostate neoplasms and benign prostatic tissue
24843874 CD56dim CD57int NK cells represent an intermediate functional phenotype in response to vaccine-induced and receptor-mediated stimuli.
24740502 NKG2C(hi)CD57+ NK cells respond specifically to acute infection with cytomegalovirus and not Epstein-Barr virus.
24585893 Abnormally low proportions of CD28(-)CD8(+) T cells expressing CD57 predict increased mortality during treated HIV infection and may be reversed with early ART initiation.
24533103 polyfunctional CD57+ cell expansion has a role in CD8+ T cell response to Staphylococcal Enterotoxin B during CMV latent infection
More...

AA Sequence

MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTE      1 - 70
YVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDTGLN     71 - 140
YTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSSQPGVVYFADDDNTYSLELFEEMRS    141 - 210
TRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKG    211 - 280
GYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI                    281 - 334
//

Text Mined References (52)

PMID Year Title
26277688 Aging-associated subpopulations of human CD8+ T-lymphocytes identified by their CD28 and CD57 phenotypes.
26013700 Aberrant NK cell associated marker (CD56 and CD57) expression in chronic lymphocytic leukemia.
25931385 2015 Differential expression of CD57 in antigen-reactive CD4+ T cells between active and latent tuberculosis infection.
25426558 2015 Patient-derived glioblastoma stem cells are killed by CD133-specific CAR T cells but induce the T cell aging marker CD57.
25275081 2014 Increase of peripheral blood CD57+ T-cells in patients with oral squamous cell carcinoma.
24977150 2014 CD57 expression in incidental, clinically manifest, and metastatic carcinoma of the prostate.
24843874 2014 Differential activation of CD57-defined natural killer cell subsets during recall responses to vaccine antigens.
24740502 2014 Cutting edge: NKG2C(hi)CD57+ NK cells respond specifically to acute infection with cytomegalovirus and not Epstein-Barr virus.
24585893 2014 Low proportions of CD28- CD8+ T cells expressing CD57 can be reversed by early ART initiation and predict mortality in treated HIV infection.
24533103 2014 CMV latent infection improves CD8+ T response to SEB due to expansion of polyfunctional CD57+ cells in young individuals.
More...