Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.48
PubTator Score 4.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q9P2W3 B2R5C8 Q52LX0 Q9UJJ3
Symbols h2-35
G(gamma)13

Gene

Gene RIF (2)

PMID Text
20660057 Observational study of gene-disease association. (HuGE Navigator)
16473877 Ggamma13 interacts with PDZ domain-containing proteins

AA Sequence

MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL         1 - 67
//

Text Mined References (16)

PMID Year Title
20660057 2010 Association between common variation in genes encoding sweet taste signaling components and human sucrose perception.
16473877 2006 Ggamma13 interacts with PDZ domain-containing proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15078334 2004 Characterization of heterotrimeric G protein complexes in rice plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626323 2003 Glucagon and regulation of glucose metabolism.
12606627 2003 Direct interactions between the heterotrimeric G protein subunit G beta 5 and the G protein gamma subunit-like domain-containing regulator of G protein signaling 11: gain of function of cyan fluorescent protein-tagged G gamma 3.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
More...