Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.48
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -1.465 2.3e-02
atypical teratoid/rhabdoid tumor -1.100 3.5e-02
ependymoma -1.200 7.0e-04
glioblastoma -1.100 1.0e-02
subependymal giant cell astrocytoma -1.965 2.6e-03

Synonym

Accession Q9P2W3 B2R5C8 Q52LX0 Q9UJJ3
Symbols h2-35
G(gamma)13

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL         1 - 67
//

Text Mined References (16)

PMID Year Title