Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.22
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 2.200 2.3e-04
nasopharyngeal carcinoma 1.200 2.4e-05
osteosarcoma -1.055 1.2e-04
ovarian cancer 1.100 3.1e-04
posterior fossa group B ependymoma 1.200 5.2e-04
primitive neuroectodermal tumor 1.300 6.4e-03
psoriasis -1.200 2.0e-04

 OMIM Phenotype (1)

Gene RIF (10)

AA Sequence

MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI      1 - 70
YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGY     71 - 140
RERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDY    141 - 210
NVTLPDP                                                                   211 - 217
//

Text Mined References (16)

PMID Year Title