Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.15
PubTator Score 15.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -3.500 0.000
osteosarcoma -3.741 0.000
group 3 medulloblastoma 2.200 0.000
primitive neuroectodermal tumor 1.300 0.006
posterior fossa group B ependymoma 1.200 0.001
nasopharyngeal carcinoma 1.200 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q9P2W1 C5ILB7 Q14458 Q8WXG2 Q96HA2
Symbols HOP2
ODG3
GT198
TBPIP
HUMGT198A

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (10)

PMID Text
24481226 PSMC3IP gene mutations are not common causes of primary ovarian insufficiency in this Swedish cohort.
24097974 GT198 mutant luteinized theca cells overexpressing CYP17 are common in ovarian cancer stroma.
21963259 a PSMC3IP/HOP2 mutation may cause XX ovarian dysgenesis through abolishing coactivation of estrogen-driven transcription
19325002 findings suggest that a component of 19S regulatory particles directly binds AR and might participate in AR-mediated transcriptional activation in cooperation with TBPIP.
18941885 Observational study of gene-disease association. (HuGE Navigator)
16407260 Data suggest that the human TBPIP/Hop2-Mnd1 complex may ensure proper pairing between homologous chromosomes through its stimulation of strand exchange during meiosis.
16407260 Data suggest that the human TBPIP/Hop2-Mnd1 complex may ensure proper pairing between homologous chromosomes through its stimulation of strand exchange during meiosis [Hop2].
11739747 Identification of GT198 (TBPIP/Hop2) as a nuclear receptor coactivator. GT198 is phosphorylation regulated. GT198 interacts with nuclear receptors.
10806355 TBPIP is a cellular protein that interacts with Tat-binding protein-1 (TBP-1) and enhances the inhibitory action of TBP-1 on Tat-mediated transactivation of the HIV-1 LTR promoter
9345291 TBPIP is a cellular protein that interacts with Tat-binding protein-1 (TBP-1) and enhances the inhibitory action of TBP-1 on Tat-mediated transactivation of the HIV-1 LTR promoter

AA Sequence

MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI      1 - 70
YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGY     71 - 140
RERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDY    141 - 210
NVTLPDP                                                                   211 - 217
//

Text Mined References (16)

PMID Year Title
24481226 2014 No mutations in the PSMC3IP gene identified in a Swedish cohort of women with primary ovarian insufficiency.
24097974 2013 Human ovarian cancer stroma contains luteinized theca cells harboring tumor suppressor gene GT198 mutations.
21963259 2011 XX ovarian dysgenesis is caused by a PSMC3IP/HOP2 mutation that abolishes coactivation of estrogen-driven transcription.
21269460 2011 Initial characterization of the human central proteome.
19325002 2009 Tat-binding protein-1 (TBP-1), an ATPase of 19S regulatory particles of the 26S proteasome, enhances androgen receptor function in cooperation with TBP-1-interacting protein/Hop2.
18941885 Two single nucleotide polymorphisms in PRDM9 (MEISETZ) gene may be a genetic risk factor for Japanese patients with azoospermia by meiotic arrest.
17716379 2007 Genomic and proteomic profiling I: leiomyomas in African Americans and Caucasians.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16407260 2006 Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...