Property Summary

NCBI Gene PubMed Count 23
Grant Count 170
R01 Count 79
Funding $23,754,941.93
PubMed Score 343.90
PubTator Score 92.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -3.600 0.008
ependymoma -4.700 0.000
oligodendroglioma -3.500 0.017
glioblastoma -3.700 0.001
osteosarcoma -1.264 0.001
atypical teratoid / rhabdoid tumor -3.000 0.006
pediatric high grade glioma -3.700 0.000
pilocytic astrocytoma -4.800 0.000
non primary Sjogren syndrome sicca -1.200 0.030
lung carcinoma 3.700 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q9P2U8 A6NKS2 VGluT2
Symbols DNPI
VGLUT2

Gene

PANTHER Protein Class (2)

Gene RIF (17)

PMID Text
26439639 Vglut2 and oligodendrocyte progenitor cells co-localize in multiple sclerosis lesions, supporting evidence that neuronal activity and release of glutamate instruct OPCs to differentiate into new myelinating oligodendrocytes that recover lost function.
26386900 This study demonstrated that Protein levels of vGLUT2 were significantly increased in schizophrenia subjects compared to controls.
25319702 Itch is regulated by VGLUT2-mediated transmission in neurons via Trpv1.
25319687 There is a glutamatergic signal from ventral tegmental area VGluT2-habenular neurons that plays a role in aversive conditioning.
22684983 This study demonistrated that Distribution of vesicular glutamate transporter 2 (VGluT2) in the primary visual cortex(V1 area)
22510271 Data indicate that GABAergic axons were labeled with vesicular inhibitory aa transporter (VIAAT) antibodies, whereas glutamatergic axons were detected with antisera against the major vesicular glutamate transporter (VGLUT) isoforms, VGLUT1 and VGLUT2.
20541370 This study may lend support to the multiple rare mutations hypothesis of schizophrenia, and may provide genetic clues to indicate the involvement of the glutamate transmission pathway in the pathogenesis of schizophrenia.
20541370 Observational study of gene-disease association. (HuGE Navigator)
20540360 Observational study of gene-disease association. (HuGE Navigator)
19839996 This study decreased VGLUT2 mRNA expression in major depressive disorder in the middle temporal gyrus, and increased VGLUT2 mRNA expression in schizophrenia in the inferior temporal gyrus.
More...

AA Sequence

MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLCDCTCFGLPRR      1 - 70
YIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWDPETVGMIHGSFFWGYIITQI     71 - 140
PGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLE    141 - 210
RSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERR    211 - 280
YIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGM    281 - 350
LSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV    351 - 420
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGG    421 - 490
VIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEK    491 - 560
KEEFVQGEVQDSHSYKDRVDYS                                                    561 - 582
//

Text Mined References (27)

PMID Year Title
26439639 2015 Neuronal activity regulates remyelination via glutamate signalling to oligodendrocyte progenitors.
26386900 2015 Uncovering the role of the nucleus accumbens in schizophrenia: A postmortem analysis of tyrosine hydroxylase and vesicular glutamate transporters.
25319702 2014 Multimodal use of calcitonin gene-related peptide and substance P in itch and acute pain uncovered by the elimination of vesicular glutamate transporter 2 from transient receptor potential cation channel subfamily V member 1 neurons.
25319687 2014 Role of glutamatergic projections from ventral tegmental area to lateral habenula in aversive conditioning.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22684983 2013 Distribution of vesicular glutamate transporter 2 (VGluT2) in the primary visual cortex of the macaque and human.
22510271 2012 Glutamatergic and GABAergic innervation of human gonadotropin-releasing hormone-I neurons.
20541370 2010 Resequencing of the vesicular glutamate transporter 2 gene (VGLUT2) reveals some rare genetic variants that may increase the genetic burden in schizophrenia.
20540360 2010 [A study of the single nucleotide polymorphism in seven genes (GHR, IGFBP3, IGFR1, IRS1, FMN1, ANXA2, TaGLN) in ethnic Russians and in patients with prostate cancer].
19839996 2009 Vesicular glutamate transporter mRNA expression in the medial temporal lobe in major depressive disorder, bipolar disorder, and schizophrenia.
More...