Property Summary

NCBI Gene PubMed Count 24
PubMed Score 372.20
PubTator Score 92.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.600 4.1e-02
astrocytic glioma -3.600 8.0e-03
Astrocytoma, Pilocytic -4.800 6.1e-08
atypical teratoid / rhabdoid tumor -3.000 6.3e-03
ependymoma -4.300 9.0e-03
glioblastoma -3.500 1.7e-05
lung carcinoma 3.700 8.9e-16
non primary Sjogren syndrome sicca -1.200 3.0e-02
oligodendroglioma -3.500 1.7e-02
osteosarcoma -1.264 1.5e-03
ovarian cancer -1.500 1.7e-08

Gene RIF (17)

AA Sequence

MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLCDCTCFGLPRR      1 - 70
YIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWDPETVGMIHGSFFWGYIITQI     71 - 140
PGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLE    141 - 210
RSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERR    211 - 280
YIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGM    281 - 350
LSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV    351 - 420
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGG    421 - 490
VIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEK    491 - 560
KEEFVQGEVQDSHSYKDRVDYS                                                    561 - 582
//

Text Mined References (27)

PMID Year Title