Property Summary

NCBI Gene PubMed Count 25
PubMed Score 347.86
PubTator Score 91.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.800 4.4e-03
astrocytic glioma -2.800 1.9e-03
Astrocytoma, Pilocytic -3.900 1.5e-07
atypical teratoid / rhabdoid tumor -4.700 3.2e-19
ependymoma -3.800 1.1e-03
glioblastoma -3.200 5.6e-08
medulloblastoma -2.200 1.1e-03
medulloblastoma, large-cell -2.400 3.7e-04
oligodendroglioma -2.300 1.8e-02
osteosarcoma 1.847 1.6e-04
ovarian cancer 1.300 6.9e-10
Pick disease -1.900 2.8e-02
primitive neuroectodermal tumor -4.400 5.9e-06
psoriasis -1.300 2.1e-41
subependymal giant cell astrocytoma -3.893 5.0e-02

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSG      1 - 70
LGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQK     71 - 140
FAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTA    141 - 210
FCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGE    211 - 280
SAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLV    281 - 350
MTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS    351 - 420
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFA    421 - 490
SGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY    491 - 560
//

Text Mined References (27)

PMID Year Title