Property Summary

NCBI Gene PubMed Count 22
Grant Count 74
R01 Count 41
Funding $10,337,546.01
PubMed Score 322.01
PubTator Score 91.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -3.800 0.004
ependymoma -3.900 0.000
oligodendroglioma -3.500 0.000
glioblastoma -4.700 0.000
osteosarcoma 2.863 0.000
sonic hedgehog group medulloblastoma -3.500 0.000
atypical teratoid / rhabdoid tumor -4.700 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -4.400 0.000
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -3.900 0.000
subependymal giant cell astrocytoma -3.893 0.050
Pick disease -1.900 0.028
ovarian cancer 1.300 0.000
psoriasis -1.300 0.000

Synonym

Accession Q9P2U7 B4DFR9 B4DG46 Q6PCD0 VGluT1
Symbols BNPI
VGLUT1

Gene

PANTHER Protein Class (2)

Gene RIF (14)

PMID Text
25749033 Loss of SLC17A7 expression is associated with glioblastoma.
23022470 Depressed patients showed significant decreases in synaptophysin (SYN) and VGLUT1 expression, whereas in bipolar patients, decreases in VGLUT1 expression have also been found.
22510271 Data indicate that GABAergic axons were labeled with vesicular inhibitory aa transporter (VIAAT) antibodies, whereas glutamatergic axons were detected with antisera against the major vesicular glutamate transporter (VGLUT) isoforms, VGLUT1 and VGLUT2.
21396926 We examined the ratio of excitatory to inhibitory vesicular neurotransmitter transporter mRNAs (VGluT1 to VGAT) and their ratio in the dorsolateral prefrontal cortex during normal human development and in people with schizophrenia
19839996 This study found decreased VGLUT1 mRNA expression in both major depressive disorder and bipolar disorder in the entorhinal cortex.
19720501 this study suggests that the common genetic variants of the VGLUT1 gene appear not play a major role in conferring susceptibility to schizophrenia in Han population of Taiwan.
19720501 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18155679 We found increased VGLUT1 transcript and reduced VGLUT1 protein expression in the ACC, but not DLPFC, in schizophrenia.
More...

AA Sequence

MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSG      1 - 70
LGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQK     71 - 140
FAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTA    141 - 210
FCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGE    211 - 280
SAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLV    281 - 350
MTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS    351 - 420
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFA    421 - 490
SGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY    491 - 560
//

Text Mined References (24)

PMID Year Title
25749033 2015 Global analysis of H3K4me3 and H3K27me3 profiles in glioblastoma stem cells and identification of SLC17A7 as a bivalent tumor suppressor gene.
23022470 2012 Alterations in the expression of PSA-NCAM and synaptic proteins in the dorsolateral prefrontal cortex of psychiatric disorder patients.
22510271 2012 Glutamatergic and GABAergic innervation of human gonadotropin-releasing hormone-I neurons.
21396926 2011 Expression of VGluT1 and VGAT mRNAs in human dorsolateral prefrontal cortex during development and in schizophrenia.
19839996 2009 Vesicular glutamate transporter mRNA expression in the medial temporal lobe in major depressive disorder, bipolar disorder, and schizophrenia.
19720501 2009 Resequencing and association study of vesicular glutamate transporter 1 gene (VGLUT1) with schizophrenia.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18155679 2008 Altered vesicular glutamate transporter expression in the anterior cingulate cortex in schizophrenia.
17660252 2007 Docking and homology modeling explain inhibition of the human vesicular glutamate transporters.
More...