Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.94
PubTator Score 3.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Adenocarcinoma 122 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 4.5e-04
Multiple myeloma 1332 2.0e-03
Disease Target Count Z-score Confidence
Gastric adenocarcinoma 3 3.085 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.118 2.0e-03
ovarian cancer -1.400 4.5e-04

Gene RIF (5)

AA Sequence

MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKF      1 - 70
SLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVE     71 - 140
FVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAH    141 - 210
GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG    211 - 280
GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC      281 - 348
//

Text Mined References (17)

PMID Year Title