Property Summary

NCBI Gene PubMed Count 6
PubMed Score 31.27
PubTator Score 13.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cholecystitis 18 3.069 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.574 3.1e-06

Gene RIF (2)

AA Sequence

MGDSRRRSLGNQPSSEAAGRSEREQDGDPRGLQSSVYESRRVTDPERQDLDNAELGPEDPEEELPPEEVA      1 - 70
GEEFPETLDPKEALSELERVLDKDLEEDIPEISRLSISQKLPSTTMTKARKRRRRRRLMELAEPKINWQV     71 - 140
LKDRKGRCGKGYAWISPCKMSLHFCLCWPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNN    141 - 210
NRTTPVWPIPRSSLEYRASSRLKELAAPKIRDNFWSMPMSEVSQVSRAAQMAVPSSRILQLSKPKAPATL    211 - 280
LEEWDPVPKPKPHVSDHNRLLHLARPKAQSDKCVPDRDPRWEVLDVTKKVVASPRIISLAKPKVRKGLNE    281 - 350
GYDRRPLASMSLPPPKASPEKCDQPRPGL                                             351 - 379
//

Text Mined References (8)

PMID Year Title