Property Summary

NCBI Gene PubMed Count 6
Grant Count 12
R01 Count 12
Funding $1,281,166.17
PubMed Score 28.82
PubTator Score 13.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cholecystitis 8 3.102 1.6
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.574 0.000

Gene RIF (2)

PMID Text
12748127 Functional analysis of the mouse counterpart.
10747865 Functional analysis of the mouse counterpart.

AA Sequence

MGDSRRRSLGNQPSSEAAGRSEREQDGDPRGLQSSVYESRRVTDPERQDLDNAELGPEDPEEELPPEEVA      1 - 70
GEEFPETLDPKEALSELERVLDKDLEEDIPEISRLSISQKLPSTTMTKARKRRRRRRLMELAEPKINWQV     71 - 140
LKDRKGRCGKGYAWISPCKMSLHFCLCWPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNN    141 - 210
NRTTPVWPIPRSSLEYRASSRLKELAAPKIRDNFWSMPMSEVSQVSRAAQMAVPSSRILQLSKPKAPATL    211 - 280
LEEWDPVPKPKPHVSDHNRLLHLARPKAQSDKCVPDRDPRWEVLDVTKKVVASPRIISLAKPKVRKGLNE    281 - 350
GYDRRPLASMSLPPPKASPEKCDQPRPGL                                             351 - 379
//

Text Mined References (8)

PMID Year Title
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12748127 2003 Male mice lacking the Theg (testicular haploid expressed gene) protein undergo normal spermatogenesis and are fertile.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11173852 2000 Alternative splicing, chromosome assignment and subcellular localization of the testicular haploid expressed gene (THEG).
10747865 2000 Insertional mutation of the murine kisimo locus caused a defect in spermatogenesis.