Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.44
PubTator Score 2.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.0e-06
osteosarcoma 7950 5.9e-05
group 3 medulloblastoma 4104 1.1e-03
non primary Sjogren syndrome sicca 891 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.1e-03
non primary Sjogren syndrome sicca 1.100 1.4e-02
osteosarcoma -1.232 5.9e-05
ovarian cancer 1.200 6.0e-06

Gene RIF (2)

AA Sequence

MNFSEVFKLSSLLCKFSPDGKYLASCVQYRLVVRDVNTLQILQLYTCLDQIQHIEWSADSLFILCAMYKR      1 - 70
GLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKSVSYIKYPKACLQGIT     71 - 140
FTRDGRYMALAERRDCKDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCLEYKILLYSLD    141 - 210
GRLLSTYSAYEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFGHPAAINDPKIVVYKEAEK    211 - 280
SPQLGLGCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRND    281 - 350
NIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLS    351 - 420
LCWHLSGDSMALLSKDHFCLCFLETEAVVGTACRQLGGHT                                  421 - 460
//

Text Mined References (14)

PMID Year Title