Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.28
PubTator Score 21.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 0.017
ependymoma 1.400 0.019
oligodendroglioma 1.500 0.006
osteosarcoma -1.094 0.003
atypical teratoid / rhabdoid tumor 1.200 0.001
juvenile dermatomyositis 1.692 0.000
acute quadriplegic myopathy 1.569 0.000
ovarian cancer -2.200 0.000
Gaucher disease type 1 -1.400 0.022

Synonym

Accession Q9P2R3 A8KA65 Q5RKV4 Q9ULG5 Rank-5
Symbols ANKHZN
BTBD23
ZFYVE14

Gene

Gene RIF (5)

PMID Text
24102721 Rabankyrin-5 is required for internalization and trafficking of the PDGF receptor.
22284051 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function
18976975 Knockdown of ankyrin repeat and FYVE domain containing 1 (ANKFY1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15328530 Rab5 regulates and coordinates different endocytic mechanisms through its effector Rabankyrin-5
10092534 Characterization of the related mouse gene

AA Sequence

MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQYSDL      1 - 70
KIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFREDDVFLTELMK     71 - 140
LANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASHWDDLRKEDFSSMSAQLL    141 - 210
YKMIKSKTEYPLHKAIKVEREDVVFLYLIEMDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKA    211 - 280
DVDMVDKSGWSLLHKGIQRGDLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIA    281 - 350
EALLQAGANPNMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSV    351 - 420
NPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATNGAHVNHRNKW    421 - 490
GETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADSVHLQTPLHMAIAYNHPDVVS    491 - 560
VILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMHTIAAQLLGSGAAINDTMSDGQTLLHMAI    561 - 630
QRQDSKSALFLLEHQADINVRTQDGETALQLAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNL    631 - 700
EDIASTLVRHGCDATCWGPGPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDG    701 - 770
QTPLHLAASWGLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLTP    771 - 840
FACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPL    841 - 910
HLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNALHLAV    911 - 980
MHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLL    981 - 1050
AYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVT   1051 - 1120
TRKHHCRHCGRLLCHKCSTKEIPIIKFDLNKPVRVCNICFDVLTLGGVS                        1121 - 1169
//

Text Mined References (24)

PMID Year Title
27189942 2016 EHD3 Protein Is Required for Tubular Recycling Endosome Stabilization, and an Asparagine-Glutamic Acid Residue Pair within Its Eps15 Homology (EH) Domain Dictates Its Selective Binding to NPF Peptides.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24102721 2013 RhoD binds the Rab5 effector Rabankyrin-5 and has a role in trafficking of the platelet-derived growth factor receptor.
24039173 2013 Genetic predictors of risk and resilience in psychiatric disorders: a cross-disorder genome-wide association study of functional impairment in major depressive disorder, bipolar disorder, and schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22284051 2012 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
More...