Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.78
PubTator Score 8.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
lung adenocarcinoma 2714 4.12698921004774E-15
non-small cell lung cancer 2798 7.06687805204759E-15
malignant mesothelioma 3163 4.31417455984949E-6
Pick disease 1893 4.59251930460441E-6
sonic hedgehog group medulloblastoma 1482 7.945929032332E-6
medulloblastoma, large-cell 6234 1.30216448851033E-5
psoriasis 6685 5.85545219136078E-4
osteosarcoma 7933 6.09231932383364E-4
adult high grade glioma 2148 8.53688611841294E-4
ductal carcinoma in situ 1745 0.00115382881312553
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00209469876914635
ovarian cancer 8492 0.00291552473775635
nasopharyngeal carcinoma 1056 0.00475564586573994
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00797932232812111
cutaneous lupus erythematosus 1056 0.00862825143096689
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00943957057559117
progressive supranuclear palsy 674 0.00968573464553189
oligodendroglioma 2849 0.0104718186249117
mucosa-associated lymphoid tissue lymphoma 480 0.0303415650709696
invasive ductal carcinoma 2950 0.0395962831053974
Endometriosis 535 0.0406799328278349
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0
Heart conduction disease 65 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Nicotine dependence 53 3.23 1.6

Expression

Synonym

Accession Q9P2Q2 A7E2Y3 Q5T377
Symbols FRMD4
CCAFCA
bA295P9.4

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
25388005 novel microcephaly, intellectual disability and dysmorphism syndrome is associated with a mutation in FRMD4A.
22564525 findings suggest FRMD4A as a novel candidate therapeutic target in HNSCC based on the key role in metastatic growth we have identified
22430674 data suggest that FRMD4A could be a relevant candidate gene for AD risk.
22006218 A single nucleotide polymorphism in the FERM domain containing 4A protein is associated with nicotine dependence.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVQLVPDSALGLLMMTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETG      1 - 70
HLNWLQLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDSEVVFE     71 - 140
LASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIV    141 - 210
ESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVHDPRRA    211 - 280
SVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTS    281 - 350
KLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELT    351 - 420
GKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSK    421 - 490
KLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDEDSQVTS    491 - 560
TISPLHSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESSLDEPYEKVKKRSSHS    561 - 630
HSSSHKRFPSTGSCAEAGGGSNSLQNSPIRGLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPTRLHS    631 - 700
LALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYST    701 - 770
LAEDSPSKARQRQRQRQRAAGALGSASSGSMPNLAARGGAGGAGGAGGGVYLHSQSQPSSQYRIKEYPLY    771 - 840
IEGGATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFKESWRGGGGDEGDTGRLTPSRSQILRTPSLG    841 - 910
REGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMC    911 - 980
KATSAALPQSQRSSTPSSEIGATPPSSPHHILTWQTGEATENSPILDGSESPPHQSTDE               981 - 1039
//

Text Mined References (26)

PMID Year Title
25864118 2015 Differential expression of microRNA in endothelial cells incubated with serum of hypertension patients with blood-stasis syndrome.
25862628 2015 DNA methylation mediates the effect of maternal smoking during pregnancy on birthweight of the offspring.
25480659 2016 DNA methylation alterations in response to prenatal exposure of maternal cigarette smoking: A persistent epigenetic impact on health from maternal lifestyle?
25388005 2015 A syndrome of congenital microcephaly, intellectual disability and dysmorphism with a homozygous mutation in FRMD4A.
25281018 2015 Transcriptomics and mechanistic elucidation of Alzheimer's disease risk genes in the brain and in vitro models.
24964093 2014 Prenatal tobacco smoke exposure is associated with childhood DNA CpG methylation.
24906187 2014 Identification of DNA methylation changes in newborns related to maternal smoking during pregnancy.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
More...