Property Summary

NCBI Gene PubMed Count 21
Grant Count 1
Funding $73,201.7
PubMed Score 9.78
PubTator Score 8.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25388005 novel microcephaly, intellectual disability and dysmorphism syndrome is associated with a mutation in FRMD4A.
22564525 findings suggest FRMD4A as a novel candidate therapeutic target in HNSCC based on the key role in metastatic growth we have identified
22430674 data suggest that FRMD4A could be a relevant candidate gene for AD risk.
22006218 A single nucleotide polymorphism in the FERM domain containing 4A protein is associated with nicotine dependence.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVQLVPDSALGLLMMTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETG      1 - 70
HLNWLQLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDSEVVFE     71 - 140
LASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIV    141 - 210
ESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVHDPRRA    211 - 280
SVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTS    281 - 350
KLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELT    351 - 420
GKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSK    421 - 490
KLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDEDSQVTS    491 - 560
TISPLHSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESSLDEPYEKVKKRSSHS    561 - 630
HSSSHKRFPSTGSCAEAGGGSNSLQNSPIRGLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPTRLHS    631 - 700
LALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYST    701 - 770
LAEDSPSKARQRQRQRQRAAGALGSASSGSMPNLAARGGAGGAGGAGGGVYLHSQSQPSSQYRIKEYPLY    771 - 840
IEGGATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFKESWRGGGGDEGDTGRLTPSRSQILRTPSLG    841 - 910
REGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMC    911 - 980
KATSAALPQSQRSSTPSSEIGATPPSSPHHILTWQTGEATENSPILDGSESPPHQSTDE               981 - 1039
//

Text Mined References (26)

PMID Year Title
25864118 2015 Differential expression of microRNA in endothelial cells incubated with serum of hypertension patients with blood-stasis syndrome.
25862628 2015 DNA methylation mediates the effect of maternal smoking during pregnancy on birthweight of the offspring.
25480659 2016 DNA methylation alterations in response to prenatal exposure of maternal cigarette smoking: A persistent epigenetic impact on health from maternal lifestyle?
25388005 2015 A syndrome of congenital microcephaly, intellectual disability and dysmorphism with a homozygous mutation in FRMD4A.
25281018 2015 Transcriptomics and mechanistic elucidation of Alzheimer's disease risk genes in the brain and in vitro models.
24964093 2014 Prenatal tobacco smoke exposure is associated with childhood DNA CpG methylation.
24906187 2014 Identification of DNA methylation changes in newborns related to maternal smoking during pregnancy.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
More...