Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.43
PubTator Score 2.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.02254615114362E-21
lung adenocarcinoma 2714 5.45966162016202E-14
posterior fossa group B ependymoma 1530 2.21952536655539E-12
glioblastoma 5572 1.0685741444897E-8
lung carcinoma 2844 1.18301535571721E-8
atypical teratoid / rhabdoid tumor 4369 1.33035392977731E-7
adult high grade glioma 2148 4.75188725450435E-7
pilocytic astrocytoma 3086 1.69435211142004E-6
cystic fibrosis 1670 5.99870287366953E-5
ovarian cancer 8492 1.33989468566943E-4
medulloblastoma, large-cell 6234 8.60389810806357E-4
medulloblastoma 1524 0.00143411479155918
interstitial cystitis 2299 0.00186698339491602
astrocytic glioma 2241 0.00408056607804228
primitive neuroectodermal tumor 3031 0.00668853887730101
oligodendroglioma 2849 0.0125590957445
spina bifida 1064 0.0166628340600373
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Imperforate anus 14 3.555 1.8

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.900 0.004
posterior fossa group B ependymoma -3.100 0.000
oligodendroglioma -1.900 0.013
glioblastoma -3.500 0.000
cystic fibrosis 1.353 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma -1.800 0.001
medulloblastoma, large-cell -2.800 0.001
primitive neuroectodermal tumor -1.800 0.007
non-small cell lung carcinoma -1.500 0.000
interstitial cystitis 1.200 0.002
lung adenocarcinoma -1.600 0.000
adult high grade glioma -3.000 0.000
pilocytic astrocytoma -2.000 0.000
lung carcinoma -1.800 0.000
spina bifida -1.429 0.017
ovarian cancer 1.300 0.000

Synonym

Accession Q9P2P5 B8ZZB4 Q17RT5 Q68DF8 Q9NPS9
Symbols NEDL2

Gene

PDB

2LFE  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 MGI Term (1)

Gene RIF (3)

PMID Text
25156441 Low HECW2 expression is associated with cervical cancer.
24163370 NEDL2 is a novel substrate of APC/C-Cdh1 as cells exit mitosis and functions as a regulator of the metaphase to anaphase transition
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQSSMPENMTLQRANSDTDLVTSESRSSLTASMYEYTL      1 - 70
GQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQIVWRIEPGPYFMEPEIKICF     71 - 140
KYYHGISGALRATTPCITVKNPAVMMGAEGMEGGASGNLHSRKLVSFTLSDLRAVGLKKGMFFNPDPYLK    141 - 210
MSIQPGKKSSFPTCAHHGQERRSTIISNTTNPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGK    211 - 280
LTIPVQRLLERQAIGDQMLSYNLGRRLPADHVSGYLQFKVEVTSSVHEDASPEAVGTILGVNSVNGDLGS    281 - 350
PSDDEDMPGSHHDSQVCSNGPVSEDSAADGTPKHSFRTSSTLEIDTEELTSTSSRTSPPRGRQDSLNDYL    351 - 420
DAIEHNGHSRPGTATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPSSLEEEGGLIM    421 - 490
FSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLPELAESSLPAGPAPEEGEGGPEPQPSA    491 - 560
DQGSAELCGSQEVDQPTSGADTGTSDASGGSRRAVSETESLDQGSEPSQVSSETEPSDPARTESVSEAST    561 - 630
RPEGESDLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQES    631 - 700
VCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEGAAAAAESPPQEEGSAGEAQGTCEGA    701 - 770
TAQEEGATGGSQANGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTTWQRPTA    771 - 840
PPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTNAIDGAGEEADFHQASADFRRENILPHSTSR    841 - 910
SRITLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMITKVRRDTHHFERYQHNRDLVGFLNMF    911 - 980
ANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLPLQSSRPTSALVHRQHLTRQRSHSAGEVGEDS    981 - 1050
RHAGPPVLPRPSSTFNTVSRPQYQDMVPVAYNDKIVAFLRQPNIFEILQERQPDLTRNHSLREKIQFIRT   1051 - 1120
EGTPGLVRLSSDADLVMLLSLFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYK   1121 - 1190
RDFEAKLRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSG   1191 - 1260
PSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLALIHQYLLDAFFTR   1261 - 1330
PFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEVFGQITERELKPGGANIPVTEK   1331 - 1400
NKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIAGTAEIDLSDWRNNTEYRGG   1401 - 1470
YHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTC   1471 - 1540
FNRLDLPPYPSFSMLYEKLLTAVEETSTFGLE                                         1541 - 1572
//

Text Mined References (14)

PMID Year Title
25156441 2015 Novel functions and targets of miR-944 in human cervical cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24163370 2013 The HECT type ubiquitin ligase NEDL2 is degraded by anaphase-promoting complex/cyclosome (APC/C)-Cdh1, and its tight regulation maintains the metaphase to anaphase transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...