Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.59
PubTator Score 2.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.800 3.9e-05
astrocytic glioma -1.500 2.4e-03
Astrocytoma, Pilocytic -2.000 1.6e-06
atypical teratoid / rhabdoid tumor -1.300 1.6e-02
cystic fibrosis 1.353 6.0e-05
ependymoma -1.500 8.7e-03
glioblastoma -1.300 6.1e-05
interstitial cystitis 1.200 1.9e-03
lung adenocarcinoma -1.500 1.2e-12
lung carcinoma -1.800 1.2e-08
medulloblastoma -1.800 1.4e-03
medulloblastoma, large-cell -1.500 3.1e-02
non-small cell lung cancer -1.487 2.6e-13
oligodendroglioma -1.400 2.1e-03
ovarian cancer 1.300 1.3e-04
primitive neuroectodermal tumor -1.800 6.7e-03
spina bifida -1.429 1.7e-02

 MGI Phenotype (1)

Gene RIF (6)

AA Sequence

MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQSSMPENMTLQRANSDTDLVTSESRSSLTASMYEYTL      1 - 70
GQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQIVWRIEPGPYFMEPEIKICF     71 - 140
KYYHGISGALRATTPCITVKNPAVMMGAEGMEGGASGNLHSRKLVSFTLSDLRAVGLKKGMFFNPDPYLK    141 - 210
MSIQPGKKSSFPTCAHHGQERRSTIISNTTNPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGK    211 - 280
LTIPVQRLLERQAIGDQMLSYNLGRRLPADHVSGYLQFKVEVTSSVHEDASPEAVGTILGVNSVNGDLGS    281 - 350
PSDDEDMPGSHHDSQVCSNGPVSEDSAADGTPKHSFRTSSTLEIDTEELTSTSSRTSPPRGRQDSLNDYL    351 - 420
DAIEHNGHSRPGTATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPSSLEEEGGLIM    421 - 490
FSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLPELAESSLPAGPAPEEGEGGPEPQPSA    491 - 560
DQGSAELCGSQEVDQPTSGADTGTSDASGGSRRAVSETESLDQGSEPSQVSSETEPSDPARTESVSEAST    561 - 630
RPEGESDLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQES    631 - 700
VCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEGAAAAAESPPQEEGSAGEAQGTCEGA    701 - 770
TAQEEGATGGSQANGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTTWQRPTA    771 - 840
PPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTNAIDGAGEEADFHQASADFRRENILPHSTSR    841 - 910
SRITLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMITKVRRDTHHFERYQHNRDLVGFLNMF    911 - 980
ANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLPLQSSRPTSALVHRQHLTRQRSHSAGEVGEDS    981 - 1050
RHAGPPVLPRPSSTFNTVSRPQYQDMVPVAYNDKIVAFLRQPNIFEILQERQPDLTRNHSLREKIQFIRT   1051 - 1120
EGTPGLVRLSSDADLVMLLSLFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYK   1121 - 1190
RDFEAKLRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSG   1191 - 1260
PSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLALIHQYLLDAFFTR   1261 - 1330
PFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEVFGQITERELKPGGANIPVTEK   1331 - 1400
NKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIAGTAEIDLSDWRNNTEYRGG   1401 - 1470
YHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTC   1471 - 1540
FNRLDLPPYPSFSMLYEKLLTAVEETSTFGLE                                         1541 - 1572
//

Text Mined References (21)

PMID Year Title