Property Summary

NCBI Gene PubMed Count 68
PubMed Score 39.59
PubTator Score 29.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.110 4.7e-02
adult high grade glioma 1.100 1.0e-03
astrocytic glioma 1.300 7.6e-03
atypical teratoid / rhabdoid tumor 1.500 7.6e-03
Breast cancer -1.100 2.7e-05
colon cancer -1.300 2.3e-02
ependymoma 1.300 1.3e-02
gastric carcinoma 1.300 2.7e-02
glioblastoma multiforme 1.300 5.2e-10
group 4 medulloblastoma -1.300 2.7e-04
head and neck cancer 1.500 1.4e-03
interstitial cystitis 1.500 1.7e-03
intraductal papillary-mucinous adenoma (... -1.400 7.9e-03
intraductal papillary-mucinous carcinoma... -2.100 4.9e-03
intraductal papillary-mucinous neoplasm ... -1.400 3.0e-02
lung cancer -2.400 4.2e-03
lung carcinoma -1.400 6.0e-07
malignant mesothelioma -1.300 5.6e-06
medulloblastoma, large-cell -1.300 3.6e-03
non diabetic and post-ischemic heart fai... -1.400 1.0e-02
non-small cell lung cancer -1.316 3.6e-11
oligodendroglioma 1.300 1.2e-02
osteosarcoma 1.540 1.2e-03
ovarian cancer -1.900 4.6e-06
psoriasis -1.200 1.3e-05
ulcerative colitis 2.100 2.2e-07

Gene RIF (56)

AA Sequence

MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALGEPFPTNVHFK      1 - 70
RTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFIAPLFTVTLLGTPGVNQTKFY     71 - 140
SEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHDGDYFIEPLQSMDEQEDEEEQNKPHIIYRRS    141 - 210
APQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKR    211 - 280
THRRTKRFLSYPRFVEVLVVADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNE    281 - 350
QDGPSISFNAQTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI    351 - 420
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSRKYITEFLDTG    421 - 490
YGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRRLWCNNVNGVHKGCRTQHTPW    491 - 560
ADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTCSRTCGGGIKTAIRECNRPEPKNGGKYCVGR    561 - 630
RMKFKSCNTEPCLKQKRDFRDEQCAHFDGKHFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQ    631 - 700
LRDRVIDGTPCGQDTNDICVQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVV    701 - 770
RIPAGATNIDVRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN    771 - 840
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKRKLVCTRESDQ    841 - 910
LTVSDQRCDRLPQPGHITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDIYCAKYSRLDGKTEKVDDGFC    911 - 980
SSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRRRAICVNTRNDVLDDSKCTHQEKVTIQRCSE    981 - 1050
FPCPQWKSGDWSECLVTCGKGHKHRQVWCQFGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCS   1051 - 1120
VTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGS   1121 - 1190
WTPCSATCGKGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRAT   1191 - 1260
RQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGN   1261 - 1330
QWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACESGPCPQWAYGNWGECTKLCGG   1331 - 1400
GIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACPHDAAWSTGPWSSCSVSCGRGHKQRNVYCMA   1401 - 1470
KDGSHLESDYCKHLAKPHGHRKCRGGRCPKWKAGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPY   1471 - 1540
TRPESERDCQGPRCPLYTWRAEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQ   1541 - 1610
PCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSAT   1611 - 1680
WRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNVYNCELPQNCKEVKRLKGASE   1681 - 1750
DGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNPTECPYNGSRRDDCQCRKDYT   1751 - 1820
AAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATAGDCYSAAKCPQGRFSINLYGTGLSLTESAR   1821 - 1890
WISQGNYAVSDIKKSPDGTRVVGKCGGYCGKCTPSSGTGLEVRVL                            1891 - 1935
//

Text Mined References (70)

PMID Year Title