Property Summary

NCBI Gene PubMed Count 65
Grant Count 15
R01 Count 6
Funding $755,461.17
PubMed Score 33.83
PubTator Score 29.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (53)

PMID Text
26620591 study identified a suggestive genome-wide significant association of ADAMTS9 with asthma in Spanish subjects
25990289 A deletion at ADAMTS9-MAGI1 locus is associated with psoriatic arthritis risk.
25760020 NF-kappaBp65 bound to elements located at -1177 and -1335 in the ADAMTS9 promoter region, in contrast to the untreated samples. The results of the present study suggested that NF-kappaB may be involved in IL-1beta-induced activation of ADAMTS9 in human chondrocytes
24833086 LncRNA ADAMTS9-AS2 is regulated by DNMT1 and inhibits migration of glioma cells.
23175174 The pathways MAPK and NF-kappaB were responsible pathways for the induction of ADAMTS9 gene.
23161442 PPARG2 and ADAMTS9 variants are both associated with type 2 diabetes mellitus and with insulin resistance, whereas only ADAMTS9 may be related to beta cell function.
23154421 The present study reveals ADAMT-9 expression by mast cells(MCs) and that MC activation regulates the expression of the protease, thus implicating the ADAMT-9 of protease in MC function.
22907434 ADAMTS9 acts as a functional tumor suppressor in gastric cancer through inhibiting oncogenic AKT/mTOR signaling pathway
22562232 Data show that the expression of ADAMTS4, 9, 16 and was up-regulated during chondrogenesis, ADAMTS1 and 5 were down-regulated.
22419820 ADAMTS9 and GON-1 in the ER that promotes protein transport from the ER to the Golgi. This function is GON-domain dependent but protease activity independent.
More...

AA Sequence

MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALGEPFPTNVHFK      1 - 70
RTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFIAPLFTVTLLGTPGVNQTKFY     71 - 140
SEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHDGDYFIEPLQSMDEQEDEEEQNKPHIIYRRS    141 - 210
APQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKR    211 - 280
THRRTKRFLSYPRFVEVLVVADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNE    281 - 350
QDGPSISFNAQTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI    351 - 420
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSRKYITEFLDTG    421 - 490
YGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRRLWCNNVNGVHKGCRTQHTPW    491 - 560
ADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTCSRTCGGGIKTAIRECNRPEPKNGGKYCVGR    561 - 630
RMKFKSCNTEPCLKQKRDFRDEQCAHFDGKHFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQ    631 - 700
LRDRVIDGTPCGQDTNDICVQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVV    701 - 770
RIPAGATNIDVRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN    771 - 840
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKRKLVCTRESDQ    841 - 910
LTVSDQRCDRLPQPGHITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDIYCAKYSRLDGKTEKVDDGFC    911 - 980
SSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRRRAICVNTRNDVLDDSKCTHQEKVTIQRCSE    981 - 1050
FPCPQWKSGDWSECLVTCGKGHKHRQVWCQFGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCS   1051 - 1120
VTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGS   1121 - 1190
WTPCSATCGKGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRAT   1191 - 1260
RQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGN   1261 - 1330
QWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACESGPCPQWAYGNWGECTKLCGG   1331 - 1400
GIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACPHDAAWSTGPWSSCSVSCGRGHKQRNVYCMA   1401 - 1470
KDGSHLESDYCKHLAKPHGHRKCRGGRCPKWKAGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPY   1471 - 1540
TRPESERDCQGPRCPLYTWRAEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQ   1541 - 1610
PCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSAT   1611 - 1680
WRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNVYNCELPQNCKEVKRLKGASE   1681 - 1750
DGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNPTECPYNGSRRDDCQCRKDYT   1751 - 1820
AAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATAGDCYSAAKCPQGRFSINLYGTGLSLTESAR   1821 - 1890
WISQGNYAVSDIKKSPDGTRVVGKCGGYCGKCTPSSGTGLEVRVL                            1891 - 1935
//

Text Mined References (67)

PMID Year Title
26620591 2016 Genome-wide association study in Spanish identifies ADAM metallopeptidase with thrombospondin type 1 motif, 9 (ADAMTS9), as a novel asthma susceptibility gene.
25990289 2015 A deletion at ADAMTS9-MAGI1 locus is associated with psoriatic arthritis risk.
25760020 2015 Interleukin-1? induced nuclear factor-?B binds to a disintegrin-like and metalloproteinase with thrombospondin type 1 motif 9 promoter in human chondrosarcoma cells.
24833086 2014 A new tumor suppressor LncRNA ADAMTS9-AS2 is regulated by DNMT1 and inhibits migration of glioma cells.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23455636 2013 Seven new loci associated with age-related macular degeneration.
23218918 2013 White matter integrity as an intermediate phenotype: exploratory genome-wide association analysis in individuals at high risk of bipolar disorder.
23175174 2013 Augmentation of ADAMTS9 gene expression by IL-1? is reversed by NF?B and MAPK inhibitors, but not PI3 kinase inhibitors.
23161442 2013 PPARG2 Pro12Ala and ADAMTS9 rs4607103 as "insulin resistance loci" and "insulin secretion loci" in Italian individuals. The GENFIEV study and the Verona Newly Diagnosed Type 2 Diabetes Study (VNDS) 4.
More...