Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.95
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.407 7.2e-06
Amyotrophic lateral sclerosis 1.324 3.5e-07
cystic fibrosis -1.075 3.3e-05
diabetes mellitus -1.400 2.6e-02
group 3 medulloblastoma 3.300 6.8e-07
Hydrolethalus syndrome -2.443 8.0e-03
intraductal papillary-mucinous neoplasm ... -1.300 4.5e-03
juvenile dermatomyositis 1.220 5.2e-09
lung adenocarcinoma -1.100 7.0e-09
lung cancer -2.700 3.8e-03
lung carcinoma -1.700 2.1e-13
malignant mesothelioma 2.000 6.1e-06
medulloblastoma, large-cell 2.100 2.2e-02
osteosarcoma 1.538 1.3e-02
ovarian cancer -3.500 2.7e-14
primitive neuroectodermal tumor 1.500 1.7e-03

Gene RIF (2)

AA Sequence

MEVEDSGGVVLTAYHSYARAQPPNAESRCAPRAAASHPLSRKSIPRCRRINRMLSNESLHPPAFSRSNSE      1 - 70
ASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVDEGELEAEWLQDVGLSTLISGDEEEDGKALLST     71 - 140
LTRTQAAAVQKRYHTYTQTMRKKDKQSIRDVRDIFGVSESPPRDTCGNHTNQLDGTKEERELPRVIKTSG    141 - 210
SMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNIP    211 - 280
PEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGLTEAGDLSAEDMKKIRHLSLIE    281 - 350
LTAFFDAFGIQLKRNKTEKVKGRDNGIFGVPLTVLLDGDRKKDPGVKVPLVLQKFFEKVEESGLESEGIF    351 - 420
RLSGCTAKVKQYREELDAKFNADKFKWDKMCHREAAVMLKAFFRELPTSLFPVEYIPAFISLMERGPHVK    421 - 490
VQFQALHLMVMALPDANRDAAQALMTFFNKVIANESKNRMSLWNISTVMAPNLFFSRSKHSDYEELLLAN    491 - 560
TAAHIIRLMLKYQKILWKVPSFLITQVRRMNEATMLLKKQLPSVRKLLRRKTLERETASPKTSKVLQKSP    561 - 630
SARRMSDVPEGVIRVHAPLLSKVSMAIQLNNQTKAKDILAKFQYENSHGSSECIKIQNQRLYEIGGNIGE    631 - 700
HCLDPDAYILDVYRINPQAEWVIKPQQSS                                             701 - 729
//

Text Mined References (11)

PMID Year Title