Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.94
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
osteosarcoma 1.733 0.036
group 3 medulloblastoma 3.300 0.000
cystic fibrosis -1.433 0.000
medulloblastoma, large-cell 2.100 0.022
primitive neuroectodermal tumor 1.500 0.002
juvenile dermatomyositis 1.220 0.000
Amyotrophic Lateral Sclerosis 1.324 0.000
acute quadriplegic myopathy 1.407 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.004
Hydrolethalus syndrome -2.443 0.008
lung cancer -3.100 0.000
diabetes mellitus -1.400 0.026
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.700 0.000
ovarian cancer -3.500 0.000

Synonym

Accession Q9P2N2 A8MQB7 A8MU88 Q6P160 Q8N4T3 Q9NW53
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
25211221 these data suggest that the regulation of Rho by RhoGAPs, including Arhgap28, during the assembly and development of mechanically strong tissues is complex and may involve multiple RhoGAPs.
24832863 The results of this study provide evidence that there are common variants within this protein that contribute to the risk for a general liability to substance dependence

AA Sequence

MEVEDSGGVVLTAYHSYARAQPPNAESRCAPRAAASHPLSRKSIPRCRRINRMLSNESLHPPAFSRSNSE      1 - 70
ASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVDEGELEAEWLQDVGLSTLISGDEEEDGKALLST     71 - 140
LTRTQAAAVQKRYHTYTQTMRKKDKQSIRDVRDIFGVSESPPRDTCGNHTNQLDGTKEERELPRVIKTSG    141 - 210
SMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNIP    211 - 280
PEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGLTEAGDLSAEDMKKIRHLSLIE    281 - 350
LTAFFDAFGIQLKRNKTEKVKGRDNGIFGVPLTVLLDGDRKKDPGVKVPLVLQKFFEKVEESGLESEGIF    351 - 420
RLSGCTAKVKQYREELDAKFNADKFKWDKMCHREAAVMLKAFFRELPTSLFPVEYIPAFISLMERGPHVK    421 - 490
VQFQALHLMVMALPDANRDAAQALMTFFNKVIANESKNRMSLWNISTVMAPNLFFSRSKHSDYEELLLAN    491 - 560
TAAHIIRLMLKYQKILWKVPSFLITQVRRMNEATMLLKKQLPSVRKLLRRKTLERETASPKTSKVLQKSP    561 - 630
SARRMSDVPEGVIRVHAPLLSKVSMAIQLNNQTKAKDILAKFQYENSHGSSECIKIQNQRLYEIGGNIGE    631 - 700
HCLDPDAYILDVYRINPQAEWVIKPQQSS                                             701 - 729
//

Text Mined References (11)

PMID Year Title
25211221 2014 Arhgap28 is a RhoGAP that inactivates RhoA and downregulates stress fibers.
24832863 2015 Association of substance dependence phenotypes in the COGA sample.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...