Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.04
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.942 0.000
group 4 medulloblastoma 2.300 0.000
lung carcinoma 1.500 0.000

Synonym

Accession Q9P2K9 Q5VTU9 Q9UJD6
Symbols PTCHD2

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
25281927 impact of DISP3 on the proliferation and differentiation of neural precursors
25041255 patched domain containing 2 (PTCHD2), yielded a statistically significant P-value of 2.5 x 10(-6) (OR = 0.27) with fewer individuals classified as exhibiting symptoms of dependence to ultraviolet light, a known carcinogen, in the context of tanning

AA Sequence

MDTEDDPLLQDVWLEEEQEEEEATGETFLGAQKPGPQPGAGGQCCWRHWPLASRPPASGFWSTLGWAFTN      1 - 70
PCCAGLVLFLGCSIPMALSAFMFLYYPPLDIDISYNAFEIRNHEASQRFDALTLALKSQFGSWGRNRRDL     71 - 140
ADFTSETLQRLISEQLQQLHLGNRSRQASRAPRVIPAASLGGPGPYRDTSAAQKPTANRSGRLRRETPPL    141 - 210
EDLAANQSEDPRNQRLSKNGRYQPSIPPHAAVAANQSRARRGASRWDYSRAYVSANTQTHAHWRIELIFL    211 - 280
ARGDAERNIFTSERLVTIHEIERKIMDHPGFREFCWKPHEVLKDLPLGSYSYCSPPSSLMTYFFPTERGG    281 - 350
KIYYDGMGQDLADIRGSLELAMTHPEFYWYVDEGLSADNLKSSLLRSEILFGAPLPNYYSVDDRWEEQRA    351 - 420
KFQSFVVTYVAMLAKQSTSKVQVLYGGTDLFDYEVRRTFNNDMLLAFISSSCIAALVYILTSCSVFLSFF    421 - 490
GIASIGLSCLVALFLYHVVFGIQYLGILNGVAAFVIVGIGVDDVFVFINTYRQATHLEDPQLRMIHTVQT    491 - 560
AGKATFFTSLTTAAAYAANVFSQIPAVHDFGLFMSLIVSCCWLAVLVTMPAALGLWSLYLAPLESSCQTS    561 - 630
CHQNCSRKTSLHFPGDVFAAPEQVGGSPAQGPIPYLDDDIPLLEVEEEPVSLELGDVSLVSVSPEGLQPA    631 - 700
SNTGSRGHLIVQLQELLHHWVLWSAVKSRWVIVGLFVSILILSLVFASRLRPASRAPLLFRPDTNIQVLL    701 - 770
DLKYNLSAEGISCITCSGLFQEKPHSLQNNIRTSLEKKRRGSGVPWASRPEATLQDFPGTVYISKVKSQG    771 - 840
HPAVYRLSLNASLPAPWQAVSPGDGEVPSFQVYRAPFGNFTKKLTACMSTVGLLQAASPSRKWMLTTLAC    841 - 910
DAKRGWKFDFSFYVATKEQQHTRKLYFAQSHKPPFHGRVCMAPPGCLLSSSPDGPTKGFFFVPSEKVPKA    911 - 980
RLSATFGFNPCVNTGCGKPAVRPLVDTGAMVFVVFGIIGVNRTRQVDNHVIGDPGSVVYDSSFDLFKEIG    981 - 1050
HLCHLCKAIAANSELVKPGGAQCLPSGYSISSFLQMLHPECKELPEPNLLPGQLSHGAVGVREGRVQWIS   1051 - 1120
MAFESTTYKGKSSFQTYSDYLRWESFLQQQLQALPEGSVLRRGFQTCEHWKQIFMEIVGVQSALCGLVLS   1121 - 1190
LLICVAAVAVFTTHILLLLPVLLSILGIVCLVVTIMYWSGWEMGAVEAISLSILVGSSVDYCVHLVEGYL   1191 - 1260
LAGENLPPHQAEDARTQRQWRTLEAVRHVGVAIVSSALTTVIATVPLFFCIIAPFAKFGKIVALNTGVSI   1261 - 1330
LYTLTVSTALLGIMAPSSFTRTRTSFLKALGAVLLAGALGLGACLVLLQSGYKIPLPAGASL           1331 - 1392
//

Text Mined References (11)

PMID Year Title
25281927 2014 DISP3 promotes proliferation and delays differentiation of neural progenitor cells.
25041255 2014 Novel gene identified in an exome-wide association study of tanning dependence.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
19179482 2009 DISP3, a sterol-sensing domain-containing protein that links thyroid hormone action and cholesterol metabolism.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16258256 2005 Hedgehog signaling pathway and gastric cancer.
15738394 2005 Identification and functional significance of genes regulated by structurally different histone deacetylase inhibitors.
15645143 2005 Identification and characterization of DISP3 gene in silico.
11181995 2001 The sequence of the human genome.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
More...