Property Summary

Ligand Count 7
NCBI Gene PubMed Count 60
PubMed Score 276.54
PubTator Score 86.88

Knowledge Summary

Patent (7,596)


  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.7e-04
cystic fibrosis -1.290 1.6e-04
glioblastoma 1.200 2.5e-04
ileal Crohn's disease -1.345 4.3e-02
osteosarcoma -1.779 6.8e-07
ovarian cancer -1.300 9.6e-05
Rheumatoid arthritis 1.100 4.6e-02
subependymal giant cell astrocytoma 1.509 5.4e-03

 GO Component (2)

Gene RIF (38)

AA Sequence

PKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF                                  1611 - 1649

Text Mined References (71)

PMID Year Title