Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.36
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.100 2.8e-03
atypical teratoid / rhabdoid tumor 1.100 3.6e-03
chronic rhinosinusitis -1.024 3.3e-02
cutaneous lupus erythematosus -2.600 4.8e-05
cystic fibrosis 1.591 1.4e-05
ductal carcinoma in situ 1.600 1.2e-02
glioblastoma -1.100 1.2e-02
group 3 medulloblastoma 1.300 3.0e-02
intraductal papillary-mucinous carcinoma... -1.500 1.6e-02
invasive ductal carcinoma 1.600 1.1e-02
lung carcinoma 2.200 4.1e-34
medulloblastoma, large-cell 1.300 1.8e-03
osteosarcoma -1.423 1.9e-02
Pick disease 1.400 2.1e-04
primitive neuroectodermal tumor 1.600 7.5e-06
psoriasis -2.900 1.7e-04

Gene RIF (4)

AA Sequence

MADANKAEVPGATGGDSPHLQPAEPPGEPRREPHPAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEK      1 - 70
STGSKKANRFHPYSKDKNSGAGEKKGPNRNRVFISNIPYDMKWQAIKDLMREKVGEVTYVELFKDAEGKS     71 - 140
RGCGVVEFKDEEFVKKALETMNKYDLSGRPLNIKEDPDGENARRALQRTGGSFPGGHVPDMGSGLMNLPP    141 - 210
SILNNPNIPPEVISNLQAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMGTVTF    211 - 280
EQAIEAVQAISMFNGQFLFDRPMHVKMDDKSVPHEEYRSHDGKTPQLPRGLGGIGMGLGPGGQPISASQL    281 - 350
NIGGVMGNLGPGGMGMDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRG    351 - 420
DIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPG    421 - 490
IGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGK    491 - 560
SKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA                                  561 - 600
//

Text Mined References (16)

PMID Year Title