Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.68
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 0.001
glioblastoma -1.400 0.004
Endometriosis -1.384 0.015
lung carcinoma 1.200 0.000
Pick disease -1.200 0.003
ovarian cancer -1.300 0.000
pituitary cancer 1.400 0.001

Synonym

Accession Q9P2K2 A5PKW9 A7E260 A7MD07 B9EH67 Q9H9W7
Symbols ERp90
KIAA1344

Gene

Gene RIF (2)

PMID Text
25122923 in addition to reported occurrence as a soluble endoplasmic reticulum-luminal glycoprotein, TXNDC16 shows endoplasmic reticulum-associated subcellular localization in cytosol, as confirmed by confocal microscopy, molecular mass shift, flow cytometry
21359175 The function of ERp90 is related to substrate recruitment or delivery to the ERAD retrotranslocation machinery by ERFAD.

AA Sequence

MFSGFNVFRVGISFVIMCIFYMPTVNSLPELSPQKYFSTLQPGKASLAYFCQADSPRTSVFLEELNEAVR      1 - 70
PLQDYGISVAKVNCVKEEISRYCGKEKDLMKAYLFKGNILLREFPTDTLFDVNAIVAHVLFALLFSEVKY     71 - 140
ITNLEDLQNIENALKGKANIIFSYVRAIGIPEHRAVMEAAFVYGTTYQFVLTTEIALLESIGSEDVEYAH    141 - 210
LYFFHCKLVLDLTQQCRRTLMEQPLTTLNIHLFIKTMKAPLLTEVAEDPQQVSTVHLQLGLPLVFIVSQQ    211 - 280
ATYEADRRTAEWVAWRLLGKAGVLLLLRDSLEVNIPQDANVVFKRAEEGVPVEFLVLHDVDLIISHVENN    281 - 350
MHIEEIQEDEDNDMEGPDIDVQDDEVAETVFRDRKRKLPLELTVELTEETFNATVMASDSIVLFYAGWQA    351 - 420
VSMAFLQSYIDVAVKLKGTSTMLLTRINCADWSDVCTKQNVTEFPIIKMYKKGENPVSYAGMLGTEDLLK    421 - 490
FIQLNRISYPVNITSIQEAEEYLSGELYKDLILYSSVSVLGLFSPTMKTAKEDFSEAGNYLKGYVITGIY    491 - 560
SEEDVLLLSTKYAASLPALLLARHTEGKIESIPLASTHAQDIVQIITDALLEMFPEITVENLPSYFRLQK    561 - 630
PLLILFSDGTVNPQYKKAILTLVKQKYLDSFTPCWLNLKNTPVGRGILRAYFDPLPPLPLLVLVNLHSGG    631 - 700
QVFAFPSDQAIIEENLVLWLKKLEAGLENHITILPAQEWKPPLPAYDFLSMIDAATSQRGTRKVPKCMKE    701 - 770
TDVQENDKEQHEDKSAVRKEPIETLRIKHWNRSNWFKEAEKSFRRDKELGCSKVN                   771 - 825
//

Text Mined References (13)

PMID Year Title
25122923 2014 Secretion and immunogenicity of the meningioma-associated antigen TXNDC16.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
21359175 2011 Identification of the PDI-family member ERp90 as an interaction partner of ERFAD.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...