Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.06
PubTator Score 10.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adrenocortical carcinoma 1428 3.9e-05
Pick disease 1894 5.7e-04
osteosarcoma 7950 6.1e-03
invasive ductal carcinoma 2951 8.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 1.456 3.9e-05
invasive ductal carcinoma -1.100 8.8e-03
osteosarcoma 1.682 6.1e-03
Pick disease 1.400 5.7e-04

Gene RIF (2)

AA Sequence

MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEE      1 - 70
DDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIF     71 - 140
DGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLR    141 - 210
VYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLH    211 - 280
VANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGD    281 - 350
VQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN    351 - 420
EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAE    421 - 490
RLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG                                   491 - 529
//

Text Mined References (12)

PMID Year Title