Property Summary

NCBI Gene PubMed Count 11
Grant Count 9
R01 Count 9
Funding $901,779.01
PubMed Score 17.75
PubTator Score 10.98

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.682 0.006
adrenocortical carcinoma 1.456 0.000
Pick disease 1.400 0.001
invasive ductal carcinoma -1.100 0.009

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20208177 catalytic subunit of PDP2 crystals belonged to space group P2(1)2(1)2(1), with unit-cell parameters a = 53.6, b = 69.1, c = 109.7 A.

AA Sequence

MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEE      1 - 70
DDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIF     71 - 140
DGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLR    141 - 210
VYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLH    211 - 280
VANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGD    281 - 350
VQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN    351 - 420
EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAE    421 - 490
RLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG                                   491 - 529
//

Text Mined References (12)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20208177 2010 Crystallization and preliminary crystallographic studies of the catalytic subunits of human pyruvate dehydrogenase phosphatase isoforms 1 and 2.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12676647 2003 Recent advances in mechanisms regulating glucose oxidation at the level of the pyruvate dehydrogenase complex by PDKs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11577086 2001 Activation and mitochondrial translocation of protein kinase Cdelta are necessary for insulin stimulation of pyruvate dehydrogenase complex activity in muscle and liver cells.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
More...