Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.75
PubTator Score 10.98

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
adrenocortical carcinoma 1427 3.889431986159E-5
Pick disease 1893 5.68926027560437E-4
osteosarcoma 7933 0.00611590014938544
invasive ductal carcinoma 2950 0.00882358843420541


  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.682 0.006
adrenocortical carcinoma 1.456 0.000
Pick disease 1.400 0.001
invasive ductal carcinoma -1.100 0.009


Accession Q9P2J9 A8K924 PDP 2
Symbols PPM2B


  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (2)

20877624 Observational study of gene-disease association. (HuGE Navigator)
20208177 catalytic subunit of PDP2 crystals belonged to space group P2(1)2(1)2(1), with unit-cell parameters a = 53.6, b = 69.1, c = 109.7 A.

AA Sequence

RLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG                                   491 - 529

Text Mined References (12)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20208177 2010 Crystallization and preliminary crystallographic studies of the catalytic subunits of human pyruvate dehydrogenase phosphatase isoforms 1 and 2.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12676647 2003 Recent advances in mechanisms regulating glucose oxidation at the level of the pyruvate dehydrogenase complex by PDKs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11577086 2001 Activation and mitochondrial translocation of protein kinase Cdelta are necessary for insulin stimulation of pyruvate dehydrogenase complex activity in muscle and liver cells.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.