Property Summary

NCBI Gene PubMed Count 33
Grant Count 78
R01 Count 34
Funding $16,757,601.06
PubMed Score 1377.76
PubTator Score 82.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.200 0.031
ependymoma 1.200 0.049
oligodendroglioma 1.600 0.012
medulloblastoma, large-cell 1.500 0.002
acute quadriplegic myopathy 1.554 0.000
tuberculosis 1.200 0.007
sonic hedgehog group medulloblastoma 1.100 0.000
ovarian cancer 2.200 0.000

Synonym

Accession Q9P2J5 A2RRR4 A7E266 B4DJ10 Q2TU79 Q9NSE1
Symbols LRS
LEUS
LFIS
ILFS1
LARS1
LEURS
PIG44
RNTLS
HSPC192
hr025Cl

Gene

PANTHER Protein Class (2)

PDB

2WFD  

Gene RIF (19)

PMID Text
25817995 the KMSKS catalytic loop affects the aminoacylation and editing capacities of leucyl-tRNA synthetase
25051973 Lack of a CP1 hairpin in LeuRS led to complete loss of aminoacylation, amino acid activation, and tRNA binding; however, the mutants retained post-transfer editing.
25010285 Tandem affinity purification and mass spectrometry analysis identify leucyl-Trna synthetase (LARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24413190 the carboxy-terminal domain of human mitochondrial (mt) leucyl-tRNA synthetase can be used to correct mt dysfunctions caused by mt-tRNA mutations.
23125841 Tandem affinity purification and mass spectrometry analysis identify leucyl-Trna synthetase (LARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify leucyl-Trna synthetase (LARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify leucyl-Trna synthetase (LARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify leucyl-Trna synthetase (LARS), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22607940 Identification of a mutation in LARS as a novel cause of infantile hepatopathy
22424946 This work demonstrates that LRS is a key mediator for amino acid signaling to mTORC1.
More...

AA Sequence

MAERKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKC      1 - 70
EFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDEEEEEEETSVKTEDIIIKDKA     71 - 140
KGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDV    141 - 210
NPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVLEPYPSKLS    211 - 280
GLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETVNGDIFICTQKAARNMSYQGFTKDNGVVPVVK    281 - 350
ELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDIAALRDLKKKQALRAKYGIRD    351 - 420
DMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLAEAKEKIYLKGFYEGIMLVDGFKGQKVQDV    421 - 490
KKTIQKKMIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWKKQTSQCLKNLETFCEETRRN    491 - 560
FEATLGWLQEHACSRTYGLGTHLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGNLHGQAESPLGIRPQQM    561 - 630
TKEVWDYVFFKEAPFPKTQIAKEKLDQLKQEFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDKW    631 - 700
PTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTW    701 - 770
VEWVKEMVANWDSLRSGPASTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAV    771 - 840
EGMHRELVFRFIEVQTLLLAPFCPHLCEHIWTLLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLR    841 - 910
LRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMP    911 - 980
ELKKYMKKVMPFVAMIKENLEKMGPRILDLQLEFDEKAVLMENIVYLTNSLELEHIEVKFASEAEDKIRE    981 - 1050
DCCPGKPLNVFRIEPGVSVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDD   1051 - 1120
PLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGDTIIYLVH                 1121 - 1176
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25817995 2015 Modulation of Aminoacylation and Editing Properties of Leucyl-tRNA Synthetase by a Conserved Structural Module.
25051973 2014 A bridge between the aminoacylation and editing domains of leucyl-tRNA synthetase is crucial for its synthetic activity.
25035493 2014 Human tRNA synthetase catalytic nulls with diverse functions.
24413190 2014 The isolated carboxy-terminal domain of human mitochondrial leucyl-tRNA synthetase rescues the pathological phenotype of mitochondrial tRNA mutations in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22607940 2012 Identification of a mutation in LARS as a novel cause of infantile hepatopathy.
22424946 2012 Leucyl-tRNA synthetase is an intracellular leucine sensor for the mTORC1-signaling pathway.
21269460 2011 Initial characterization of the human central proteome.
More...