Property Summary

NCBI Gene PubMed Count 6
PubMed Score 34.86
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.340 3.1e-02
active ulcerative colitis -1.097 4.5e-02
atypical teratoid/rhabdoid tumor 1.100 2.5e-05
Breast cancer 1.100 7.5e-06
breast carcinoma 1.600 3.2e-03
ductal carcinoma in situ 1.800 6.7e-04
fibroadenoma 1.700 2.2e-02
group 3 medulloblastoma 2.900 3.8e-06
intraductal papillary-mucinous neoplasm ... 1.100 2.1e-03
invasive ductal carcinoma 2.300 3.3e-03
lung adenocarcinoma 2.600 8.8e-12
medulloblastoma, large-cell 2.000 5.0e-04
non-small cell lung cancer 2.625 2.1e-22
ovarian cancer -1.900 3.8e-13
primitive neuroectodermal tumor 1.400 2.2e-02

AA Sequence

MVWCLGLAVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQF      1 - 70
GLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQE     71 - 140
TPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQVQNGTLRIRRVERGSSGVYTCQASS    141 - 210
TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRI    211 - 280
LVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANP    281 - 350
PLLFVSWTKDGKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAF    351 - 420
IERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVDSNSSLILRPLTKEAHGHWECSASN    421 - 490
AVARVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHDWVSL    491 - 560
AVPVGAAHLLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVLSAPEGLPTTPAAPGLPPTEIPPPLSPPRGL    561 - 630
VAVRTPRGVLLHWDPPELVPKRLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFA    631 - 700
GSFVSDPSNTANVSTSGLEVYPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAGCLLNRRRAARRRR    701 - 770
KRLRQDPPLIFSPTGKSAAPSALGSGSPDSVAKLKLQGSPVPSLRQSLLWGDPAGTPSPHPDPPSSRGPL    771 - 840
PLEPICRGPDGRFVMGPTVAAPQERSGREQAEPRTPAQRLARSFDCSSSSPSGAPQPLCIEDISPVAPPP    841 - 910
AAPPSPLPGPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRRCPTSSFLRSPETPPVSPRES    911 - 980
LPGAVVGAGATAEPPYTALADWTLRERLLPGLLPAAPRGSLTSQSSGRGSASFLRPPSTAPSAGGSYLSP    981 - 1050
APGDTSSWASGPERWPRREHVVTVSKRRNTSVDENYEWDSEFPGDMELLETLHLGLASSRLRPEAEPELG   1051 - 1120
VKTPEEGCLLNTAHVTGPEARCAALREEFLAFRRRRDATRARLPAYRQPVPHPEQATLL              1121 - 1179
//

Text Mined References (8)

PMID Year Title