Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.06
PubTator Score 3.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 9.67100885450986E-13
atypical teratoid / rhabdoid tumor 4369 9.01786748888885E-9
medulloblastoma, large-cell 6234 6.12391068006283E-8
lung carcinoma 2844 2.07785499461387E-7
group 3 medulloblastoma 2254 9.67982313449866E-7
glioblastoma 5572 1.15365412536407E-5
adult high grade glioma 2148 2.0734187557689E-5
osteosarcoma 7933 3.65670163319694E-4
pilocytic astrocytoma 3086 4.91110718057792E-4
ovarian cancer 8492 7.05998401775194E-4
ductal carcinoma in situ 1745 0.00110744023698808
primitive neuroectodermal tumor 3031 0.00116327558072085
posterior fossa group B ependymoma 1530 0.00128492372141193
astrocytic glioma 2241 0.0102088425165322
chronic rhinosinusitis 512 0.0162033449004731
cystic fibrosis and chronic rhinosinusitis 213 0.0391821560022012
invasive ductal carcinoma 2950 0.0408964139697735
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Amyotrophy, Monomelic 2

Expression

Synonym

Accession Q9P2H0 Q4G0U6
Symbols KIAA1377

Gene

  Ortholog (1)

Species Source
Mouse EggNOG Inparanoid

Gene RIF (2)

PMID Text
24867236 CEP126 is a regulator of microtubule organisation at the centrosome that acts through modulation of the transport of pericentriolar satellites, and consequently, of the organisation of cell structure
22264561 KIAA1377 and C5orf42 gene synergistically play a role as susceptibility genes for monomelic amyotrophy.

AA Sequence

MLAGRPGTRSAVGELGTESSDNLDRAPLGPRESGGHHRPGSYLDMKIHLEKNLEEERQILLQQQKICRNR      1 - 70
ARKYFVESNRRKKAFEEKRKEQEEKEHQIREQILQQRKQKFEEVTEKFQRAHVPLSQRRKAVSRKPVPPL     71 - 140
EEALKQIQESNLKSEVNLPFSRRPTINWRAIDSALPSALSKNDHKHQKQLLSKINCEKEMNENMRATLAT    141 - 210
SKNVFQLKLEETQKLLEDQHLSNLQKFGDEVNQITNSETLSSIDSLEATEHEEIYLTLNKEHSTSIQRNT    211 - 280
ISLKPANMQSTNLSCFDEDKLAFSKTQHINNWLTNLDASNTQNVTAFSDILSKSNVLPSWEYFNSKEQNP    281 - 350
SPLNGTVERATNTANNSVPFVSSPPMFVLDKKCEKTSETSTMRTTDSTSGAFKRERPLVTESPTFKFSKS    351 - 420
QSTSDSLTQEVATFPDQEKYSELNQENGTTSIPTSCVPVATPLVLPSNIQSARPSAKNSIHIKEIDAVQC    421 - 490
SDKLDELKDGKEEEIKYFNCNKEELPLFSDSFQDAYIPHNPDSKDEKQKLAETSSLSNVTSNYDFVGQHK    491 - 560
KMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKL    561 - 630
RWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAGSNIISVSTCAVNSADTKKSREDSISENVTT    631 - 700
LGGSGADHMPLNCFIPSGYNFAKHAWPASKKEESKIPVHDDSKTKQGKPQRGRAKIIRKPGSAKVQSGFI    701 - 770
CTNRKGAVIQPQSASKVNIFTQAQGKLIIPCPPPQSTSNIRSGKNIQVSQCQPVTPENPQNIITHNSFNS    771 - 840
KHVLPTEHSLNQWNQESSSPLSNACSDLVTVIPSLPSYCSSECQTFAKINHSNGTQAVARQDATLYCTQR    841 - 910
SPVCEESYPSVTLRTAEEESVPLWKRGPNVLHQNKRATGSTVMRRKRIAETKRRNILEQKRQNPGSVGQK    911 - 980
YSEQINNFGQSVLLSSSEPKQTTRGTSYIEEVSDSTSEFLMAENLVKASVPEDEILTVLNSKQIQKSNLP    981 - 1050
LNKTQQFNICTLSAEEQKILESLNDLSERLHYIQESICKNPSIKNTLQIIPLLEKREDRTSSCRDKR      1051 - 1117
//

Text Mined References (14)

PMID Year Title
24867236 2014 Cep126 is required for pericentriolar satellite localisation to the centrosome and for primary cilium formation.
22712476 2012 Identification of novel mitosis regulators through data mining with human centromere/kinetochore proteins as group queries.
22264561 2012 Exome sequencing identifies KIAA1377 and C5orf42 as susceptibility genes for monomelic amyotrophy.
19799413 2009 From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12812986 2003 DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation.
More...