Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.12
PubTator Score 3.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.600 2.1e-05
astrocytic glioma -1.500 1.0e-02
Astrocytoma, Pilocytic -1.300 2.5e-04
atypical teratoid / rhabdoid tumor -2.900 9.0e-09
chronic rhinosinusitis -1.547 1.7e-02
cystic fibrosis and chronic rhinosinusit... -1.096 3.9e-02
ductal carcinoma in situ -1.900 1.1e-03
glioblastoma -2.400 1.0e-07
group 3 medulloblastoma -3.200 1.8e-05
invasive ductal carcinoma -1.700 4.1e-02
lung carcinoma 1.300 2.1e-07
medulloblastoma, large-cell -3.900 6.1e-08
non-small cell lung cancer -1.535 9.7e-13
osteosarcoma -1.645 3.7e-04
ovarian cancer -1.300 7.1e-04
posterior fossa group B ependymoma 1.300 1.3e-03
primitive neuroectodermal tumor -1.700 1.2e-03

Gene RIF (2)

AA Sequence

MLAGRPGTRSAVGELGTESSDNLDRAPLGPRESGGHHRPGSYLDMKIHLEKNLEEERQILLQQQKICRNR      1 - 70
ARKYFVESNRRKKAFEEKRKEQEEKEHQIREQILQQRKQKFEEVTEKFQRAHVPLSQRRKAVSRKPVPPL     71 - 140
EEALKQIQESNLKSEVNLPFSRRPTINWRAIDSALPSALSKNDHKHQKQLLSKINCEKEMNENMRATLAT    141 - 210
SKNVFQLKLEETQKLLEDQHLSNLQKFGDEVNQITNSETLSSIDSLEATEHEEIYLTLNKEHSTSIQRNT    211 - 280
ISLKPANMQSTNLSCFDEDKLAFSKTQHINNWLTNLDASNTQNVTAFSDILSKSNVLPSWEYFNSKEQNP    281 - 350
SPLNGTVERATNTANNSVPFVSSPPMFVLDKKCEKTSETSTMRTTDSTSGAFKRERPLVTESPTFKFSKS    351 - 420
QSTSDSLTQEVATFPDQEKYSELNQENGTTSIPTSCVPVATPLVLPSNIQSARPSAKNSIHIKEIDAVQC    421 - 490
SDKLDELKDGKEEEIKYFNCNKEELPLFSDSFQDAYIPHNPDSKDEKQKLAETSSLSNVTSNYDFVGQHK    491 - 560
KMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKL    561 - 630
RWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAGSNIISVSTCAVNSADTKKSREDSISENVTT    631 - 700
LGGSGADHMPLNCFIPSGYNFAKHAWPASKKEESKIPVHDDSKTKQGKPQRGRAKIIRKPGSAKVQSGFI    701 - 770
CTNRKGAVIQPQSASKVNIFTQAQGKLIIPCPPPQSTSNIRSGKNIQVSQCQPVTPENPQNIITHNSFNS    771 - 840
KHVLPTEHSLNQWNQESSSPLSNACSDLVTVIPSLPSYCSSECQTFAKINHSNGTQAVARQDATLYCTQR    841 - 910
SPVCEESYPSVTLRTAEEESVPLWKRGPNVLHQNKRATGSTVMRRKRIAETKRRNILEQKRQNPGSVGQK    911 - 980
YSEQINNFGQSVLLSSSEPKQTTRGTSYIEEVSDSTSEFLMAENLVKASVPEDEILTVLNSKQIQKSNLP    981 - 1050
LNKTQQFNICTLSAEEQKILESLNDLSERLHYIQESICKNPSIKNTLQIIPLLEKREDRTSSCRDKR      1051 - 1117
//

Text Mined References (14)

PMID Year Title