Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.75
PubTator Score 0.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 2.100 0.010
pancreatic cancer 1.400 0.001
osteosarcoma 2.075 0.000
posterior fossa group B ependymoma -1.600 0.000
pancreatic carcinoma 1.400 0.001
aldosterone-producing adenoma -1.005 0.038
ulcerative colitis -1.200 0.000
ovarian cancer 1.100 0.018

Synonym

Accession Q9P2G9 Q53XA3 Q6N018
Symbols

Gene

Gene RIF (1)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASDSMSSKQARNHITKGKRQQQHQQIKNRSSISDGDGEDSFIFEANEAWKDFHGSLLRFYENGELCDVT      1 - 70
LKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDGDAIEDLVKFVYSSRLTLTVDNVQPL     71 - 140
LYAACILQVELVARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHFTEVVECEDFVSVSP    141 - 210
QHLHKLLSSSDLNIENEKQVYNAAIKWLLANPQHHSKWLDETLAQVRLPLLPVDFLMGVVAKEQIVKQNL    211 - 280
KCRDLLDEARNYHLHLSSRAVPDFEYSIRTTPRKHTAGVLFCVGGRGGSGDPFRSIECYSINKNSWFFGP    281 - 350
EMNSRRRHVGVISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGG    351 - 420
LDDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVALVNHVYAVGGNDGMASLSSVERYDPHLDKWIEV    421 - 490
KEMGQRRAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKIFAVG    491 - 560
GHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVAVCSCLTSQIRDVGHGSNNVVDCM              561 - 620
//

Text Mined References (18)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23568457 2013 Genetic variants associated with disordered eating.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19158078 2009 Control of rapsyn stability by the CUL-3-containing E3 ligase complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
More...