Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.07
PubTator Score 0.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 1.6e-02
Astrocytoma, Pilocytic -1.800 5.4e-04
ependymoma -1.100 2.1e-02
glioblastoma -1.200 2.5e-02
group 4 medulloblastoma -1.900 1.5e-02
interstitial cystitis 2.000 1.1e-02
non primary Sjogren syndrome sicca -1.400 9.1e-03
oligodendroglioma -1.100 1.4e-02
osteosarcoma -3.163 8.8e-04
ovarian cancer 1.100 5.7e-07
pancreatic cancer 1.600 3.9e-02
pancreatic carcinoma 1.600 3.9e-02
tuberculosis 2.200 6.9e-06

 GO Process (1)

Gene RIF (3)

AA Sequence

MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRSLFSSHPPLGG      1 - 70
GVGGQDGLGAPKDQQQPPQQQPSQQQQPPPQEEPGTPSSSPDDKLLTSPRAINNLVLQGCSSIGLRLVLE     71 - 140
YLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEETKKLANKYLV    141 - 210
EDVLLLNFEEMRALLDSLPPPVESELALFQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQS    211 - 280
VDFMRTDPVCQKLLLDAMNYHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKK    281 - 350
TWKILTIMPYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFYAC    351 - 420
RLDKHLYVIGGRNETGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGGVHNGEYVPWLYC    421 - 490
YDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVMLVECYDPKGDQWNILQTPILEGR    491 - 560
SGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGTWTELEGDVAEPLAGPACVTVILPSCVPYNK      561 - 628
//

Text Mined References (10)

PMID Year Title