Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.12
PubTator Score 0.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.972 1.5e-05
atypical teratoid / rhabdoid tumor -2.000 3.5e-04
cystic fibrosis -1.491 7.5e-06
Endometriosis -1.068 7.3e-03
ependymoma -1.500 2.0e-05
gastric carcinoma 1.900 1.2e-02
group 4 medulloblastoma -3.200 2.8e-06
Hydrolethalus syndrome 2.498 3.9e-02
intraductal papillary-mucinous carcinoma... 1.900 1.4e-02
invasive ductal carcinoma 1.100 1.5e-02
mucosa-associated lymphoid tissue lympho... 1.050 3.6e-02
osteosarcoma 1.345 2.8e-04
ovarian cancer -2.200 9.7e-07
pancreatic cancer 1.700 8.5e-04
pituitary cancer -1.400 8.7e-04
primary pancreatic ductal adenocarcinoma 1.797 2.7e-04
Rheumatoid arthritis 1.100 9.5e-04

Gene RIF (2)

AA Sequence

MSDPRQSQEEKHKLGRASSKFKDPPRIMQSDDYFARKFKAINGNMGPTTSLNASNSNETGGGGPANGTPA      1 - 70
VPKMGVRARVSEWPPKKDCSKELTCKALWESRSQTSYESITSVLQNGQSDQSEGQQDEQLDLDFVEAKYT     71 - 140
IGDIFVHSPQRGLHPIRQRSNSDVTISDIDAEDVLDQNAVNPNTGAALHREYGSTSSIDRQGLSGENFFA    141 - 210
MLRGYRVENYDHKAMVPFGFPEFFRCDPAISPSLHAAAQISRGEFVRISGLDYVDSALLMGRDRDKPFKR    211 - 280
RLKSESVETSLFRKLRTVKSEHETFKFTSELEESRLERGIRPWNCQRCFAHYDVQSILFNINEAMATRAN    281 - 350
VGKRKNITTGASAASQTQMPTGQTGNCESPLGSKEDLNSKENLDADEGDGKSNDLVLSCPYFRNETGGEG    351 - 420
DRRIALSRANSSSFSSGESCSFESSLSSHCTNAGVSVLEVPRENQPIHREKVKRYIIEHIDLGAYYYRKF    421 - 490
FYGKEHQNYFGIDENLGPVAVSIRREKVEDAKEKEGSQFNYRVAFRTSELTTLRGAILEDAIPSTARHGT    491 - 560
ARGLPLKEVLEYVIPELSIQCLRQASNSPKVSEQLLKLDEQGLSFQHKIGILYCKAGQSTEEEMYNNETA    561 - 630
GPAFEEFLDLLGQRVRLKGFSKYRAQLDNKTDSTGTHSLYTTYKDYELMFHVSTLLPYMPNNRQQLLRKR    631 - 700
HIGNDIVTIVFQEPGALPFTPKSIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTF    701 - 770
PKSAVFRDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSVKFSFITLGAKKKEK    771 - 840
VKPRKDAHLFSIGAIMWHVIARDFGQSADIECLLGISNEFIMLIEKDSKNVVFNCSCRDVIGWTSGLVSI    841 - 910
KVFYERGECVLLSSVDNCAEDIREIVQRLVIVTRGCETVEMTLRRNGLGQLGFHVNFEGIVADVEPFGFA    911 - 980
WKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKVVIIQPHDDGSPRRGCSELCRIPMVEYKLDSE    981 - 1050
GTPCEYKTPFRRNTTWHRVPTPALQPLSRASPIPGTPDRLPCQQLLQQAQAAIPRSTSFDRKLPDGTRSS   1051 - 1120
PSNQSSSSDPGPGGSGPWRPQVGYDGCQSPLLLEHQGSGPLECDGAREREDTMEASRHPETKWHGPPSKV   1121 - 1190
LGSYKERALQKDGSCKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIKG   1191 - 1260
ASTDSGIDTAPCMPATILGPVHLAGSRSLIHSRAEQWADAADVSGPDDEPAKLYSVHGYASTISAGSAAE   1261 - 1330
GSMGDLSEISSHSSGSHHSGSPSAHCSKSSGSLDSSKVYIVSHSSGQQVPGSMSKPYHRQGAVNKYVIGW   1331 - 1400
KKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPDSPLVEEGRRK   1401 - 1470
FSFYGNLSPRRSLYRTLSDESICSNRRGSSFGSSRSSVLDQALPNDILFSTTPPYHSTLPPRAHPAPSMG   1471 - 1540
SLRNEFWFSDGSLSDKSKCADPGLMPLPDTATGLDWTHLVDAARAFEGLDSDEELGLLCHHTSYLDQRVA   1541 - 1610
SFCTLTDMQHGQDLEGAQELPLCVDPGSGKEFMDTTGERSPSPLTGKVNQLELILRQLQTDLRKEKQDKA   1611 - 1680
VLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWFFTTIDKKS                               1681 - 1722
//

Text Mined References (26)

PMID Year Title