Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.29
PubTator Score 5.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
Breast cancer 3099 2.64576108919326E-100
atypical teratoid / rhabdoid tumor 4369 7.14967708882963E-14
ovarian cancer 8492 1.17192234821044E-11
medulloblastoma 1524 2.20370576992224E-6
cystic fibrosis 1670 2.88891444025416E-5
invasive ductal carcinoma 2950 8.37242124481417E-5
pituitary cancer 1972 9.1996984567944E-5
breast carcinoma 1614 1.55393413098016E-4
ductal carcinoma in situ 1745 1.94016186362649E-4
glioblastoma 5572 2.43082275240098E-4
astrocytic glioma 2241 5.75960818387636E-4
medulloblastoma, large-cell 6234 0.00193593861499968
primitive neuroectodermal tumor 3031 0.00273334036257527
oligodendroglioma 2849 0.00291804586766969
pediatric high grade glioma 2712 0.00304236814356888
ependymoma 2514 0.0044439681595699
fibroadenoma 557 0.0213250551973497
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Malaria 140 0.0 2.0

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.100 0.001
ependymoma -2.300 0.004
oligodendroglioma -1.800 0.003
glioblastoma -2.400 0.000
medulloblastoma -2.900 0.000
cystic fibrosis 1.746 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -2.100 0.002
primitive neuroectodermal tumor -2.500 0.003
breast carcinoma -1.500 0.000
fibroadenoma -1.500 0.021
pediatric high grade glioma -1.600 0.003
Breast cancer -2.100 0.000
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -2.500 0.000
ovarian cancer -1.500 0.000
pituitary cancer 2.400 0.000

Synonym

Accession Q9P2F6 A8K8C5 B0YIW7 B0YIW8 Q6RJU1 Q6RJU2 Q6RJU3 Q6RJU5 Q8IXS1
Symbols RARHOGAP

Gene

PANTHER Protein Class (2)

PDB

3MSX  

  Ortholog (12)

Gene RIF (4)

PMID Text
21500311 The similar expression profiles of ARHGAP20 in 13q14 and 11q22-23 deleted CLL cases suggest a molecular connection and an intriguing mechanism of regulation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16014623 RA-RhoGAP transduces a signal from Rap1 to Rho and regulates the neurite outgrowth
14532992 human KIAA1391 gene and mouse Kiaa1391 gene encode RhoGAP proteins with RA domain and two ANXL repeats

AA Sequence

MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTKKKMKTLAERRRSAPSLILDKALQKRPTTRDSPSASV      1 - 70
DTCTFLSSLVCSNRTLLIDGRAELKRGLQRQERHLFLFNDLFVVAKIKYNNNFKIKNKIKLTDMWTASCV     71 - 140
DEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQKDKWLSLLQRYINLEKEKDYPKSIPLKIFAKDIGNCAY    141 - 210
SKTITVMNSDTANEVINMSLPMLGITGSERDYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDSALLTPG    211 - 280
SKDSTTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNL    281 - 350
PSSPTSPMPGQLFGISLPNICENDNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV    351 - 420
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFG    421 - 490
VLHNIEQHSSSNQMTAFNLAVCVAPSILWPPASSSPELENEFTKKVSLLIQFLIENCLRIFGEEITSLFR    491 - 560
EVSVRCDTRENASDISCFQLNDSSYDSLENELNEDVDAPCSDLVKKLGQGSRSMDSVLTLSDYDLDQPEV    561 - 630
EGLLTLSDFDLAHSKDEDVQMKRPLESKPVNILVYTKIPLRDHARAPSAMCTPSYLSTAAANAAKSLRRH    631 - 700
RRCSEPSIDYLDSKLSYLREFYQKKLRKSSCDAILSQKDEDYLKQNQPLQEEGKTCFKQSLVTGTDVSKK    701 - 770
NATTQNTKKKSLSGSEGNHVKLFPKSKPVAISVASYSPMSSQDHSKNQPFDVNTSGYSPPHTADALKGPR    771 - 840
THRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVG    841 - 910
KSSATNQNTEKVLPPRLNLCPRTSYSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQ    911 - 980
AQRKREDLSPDFSNASHVSGMPGPSSGQACSRPAYTKKDTMEWHSQMHSVTLHPSTWLRNGVASLKNWSL    981 - 1050
KKKAKAARPEEEKIASPKGPLEPPPHASGVPEANSLQEEQKDLPLRAAEGLSPVQSAQRCSSSPFQDSER   1051 - 1120
HCSSPFSLVESRLKLCMKSHEEIEPGSQSSSGSLPWERASASSWTLEDATSPDSGPTVVCDIEDRYLTKD   1121 - 1190
I//

Text Mined References (13)

PMID Year Title
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22044751 2011 Heritability and genome-wide association analysis of renal sinus fat accumulation in the Framingham Heart Study.
21500311 2011 Expression analysis of genes located in the minimally deleted regions of 13q14 and 11q22-23 in chronic lymphocytic leukemia-unexpected expression pattern of the RHO GTPase activator ARHGAP20.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16014623 2005 RA-RhoGAP, Rap-activated Rho GTPase-activating protein implicated in neurite outgrowth through Rho.
15543602 2005 Translocation t(X;11)(q13;q23) in B-cell chronic lymphocytic leukemia disrupts two novel genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15234003 2004 Identification of RARhoGAP, a novel putative RhoGAP gene expressed in male germ cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...