Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.29
PubTator Score 5.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 1.9e-02
astrocytic glioma -2.100 5.8e-04
atypical teratoid / rhabdoid tumor -3.700 7.1e-14
Breast cancer -2.100 2.6e-100
breast carcinoma -1.500 1.6e-04
cystic fibrosis 1.746 2.9e-05
ductal carcinoma in situ -1.800 1.9e-04
ependymoma -2.300 4.4e-03
fibroadenoma -1.500 2.1e-02
glioblastoma -1.400 3.3e-04
group 3 medulloblastoma -2.100 1.0e-02
invasive ductal carcinoma -2.500 8.4e-05
medulloblastoma, large-cell -2.100 1.9e-03
oligodendroglioma -1.800 2.9e-03
ovarian cancer -1.500 1.2e-11
pituitary cancer 2.400 9.2e-05
primitive neuroectodermal tumor -2.500 2.7e-03

Gene RIF (4)

AA Sequence

MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTKKKMKTLAERRRSAPSLILDKALQKRPTTRDSPSASV      1 - 70
DTCTFLSSLVCSNRTLLIDGRAELKRGLQRQERHLFLFNDLFVVAKIKYNNNFKIKNKIKLTDMWTASCV     71 - 140
DEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQKDKWLSLLQRYINLEKEKDYPKSIPLKIFAKDIGNCAY    141 - 210
SKTITVMNSDTANEVINMSLPMLGITGSERDYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDSALLTPG    211 - 280
SKDSTTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNL    281 - 350
PSSPTSPMPGQLFGISLPNICENDNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV    351 - 420
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFG    421 - 490
VLHNIEQHSSSNQMTAFNLAVCVAPSILWPPASSSPELENEFTKKVSLLIQFLIENCLRIFGEEITSLFR    491 - 560
EVSVRCDTRENASDISCFQLNDSSYDSLENELNEDVDAPCSDLVKKLGQGSRSMDSVLTLSDYDLDQPEV    561 - 630
EGLLTLSDFDLAHSKDEDVQMKRPLESKPVNILVYTKIPLRDHARAPSAMCTPSYLSTAAANAAKSLRRH    631 - 700
RRCSEPSIDYLDSKLSYLREFYQKKLRKSSCDAILSQKDEDYLKQNQPLQEEGKTCFKQSLVTGTDVSKK    701 - 770
NATTQNTKKKSLSGSEGNHVKLFPKSKPVAISVASYSPMSSQDHSKNQPFDVNTSGYSPPHTADALKGPR    771 - 840
THRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVG    841 - 910
KSSATNQNTEKVLPPRLNLCPRTSYSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQ    911 - 980
AQRKREDLSPDFSNASHVSGMPGPSSGQACSRPAYTKKDTMEWHSQMHSVTLHPSTWLRNGVASLKNWSL    981 - 1050
KKKAKAARPEEEKIASPKGPLEPPPHASGVPEANSLQEEQKDLPLRAAEGLSPVQSAQRCSSSPFQDSER   1051 - 1120
HCSSPFSLVESRLKLCMKSHEEIEPGSQSSSGSLPWERASASSWTLEDATSPDSGPTVVCDIEDRYLTKD   1121 - 1190
I//

Text Mined References (13)

PMID Year Title