Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.84
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.166 2.1e-02
active ulcerative colitis -1.099 6.0e-03
adult high grade glioma -1.400 1.5e-04
astrocytic glioma -1.600 4.5e-03
Astrocytoma, Pilocytic -1.300 4.0e-07
atypical teratoid / rhabdoid tumor -1.900 6.3e-03
Breast cancer -1.700 3.7e-17
breast carcinoma -1.400 2.7e-07
ductal carcinoma in situ -1.200 2.2e-02
ependymoma -1.500 1.3e-02
glioblastoma -1.100 2.5e-05
group 4 medulloblastoma 1.100 2.9e-03
interstitial cystitis -1.100 8.9e-03
medulloblastoma, large-cell -1.400 3.7e-02
oligodendroglioma -1.300 1.6e-02
ovarian cancer -1.500 5.9e-04
progressive supranuclear palsy 1.200 2.7e-02

Gene RIF (3)

AA Sequence

MKKTRSTTLRRAWPSSDFSDRASDRMRSRSEKDYRLHKRFPAAFAPQASRGYMTSGDVSPISMSPISQSQ      1 - 70
FIPLGEILCLAISAMNSARKPVTQEALMEHLTTCFPGVPTPSQEILRHTLNTLVRERKIYPTPDGYFIVT     71 - 140
PQTYFITPSLIRTNSKWYHLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTH    141 - 210
APTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPKDSEKQSKKFGLKLFRLSFKKDKT    211 - 280
KQLANFSAQFPPEEWPLRDEDTPATIPREVEMEIIRRINPDLTVENVMRHTALMKKLEEEKAQRSKAGSS    281 - 350
AHHSGRSKKSRTHRKSHGKSRSHSKTRVSKGDPSDGSHLDIPAEREYDFCDPLTRVPREGCFIIEHKGDN    351 - 420
FIMHSNTNVLESHFPMTPEWDVSGELAKRRTEMPFPEPSRGSSHSKVHRSHSHTQDRRSRNERSNKAKER    421 - 490
SRSMDNSKGPLGASSLGTPEDLAEGCSQDDQTPSQSYIDDSTLRPAQTVSLQRAHISSTSYKEVCIPEIV    491 - 560
SGSKEPSSACSLLEPGKPPESLPSYGELNSCPTKTATDDYFQCNTSSETVLTAPSPLGKNKEDHDTLTLA    561 - 630
EGVKKLSPSDRQVPHSSREPVGHKEESPKGPGGGPAASGGVAEGIANGRLVQHHGAEPSSLDKRKEIFSK    631 - 700
DTLFKPLHSTLSVNSYHKSSLSLLKSHPKTPADTLPGRCEKLEPSLGTSAAQAMPASQRQQESGGNQEAS    701 - 770
FDYYNVSDDDDSEEGANKNTEEEKNREDVGTMQWLLEREKERDLQRKFEKNLTLLAPKETDSSSNQRATH    771 - 840
SARLDSMDSSSITVDSGFNSPRTRESLASNTSSIVESNRRQNPALSPAHGGAGPAFNFRASAEPPTNEAE    841 - 910
KLQKPSNCLQASVTSV                                                          911 - 926
//

Text Mined References (9)

PMID Year Title