Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.84
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.600 0.005
ependymoma -1.500 0.013
oligodendroglioma -1.300 0.016
glioblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.200 0.002
medulloblastoma, large-cell -2.500 0.015
active Crohn's disease -1.166 0.021
active ulcerative colitis -2.675 0.002
breast carcinoma -1.400 0.000
interstitial cystitis -1.100 0.009
adult high grade glioma -1.900 0.000
group 4 medulloblastoma 1.100 0.003
pilocytic astrocytoma -1.400 0.000
Breast cancer -2.500 0.000
progressive supranuclear palsy 1.200 0.027
ductal carcinoma in situ -1.200 0.022
ovarian cancer -1.500 0.001

Gene RIF (2)

PMID Text
20643876 STOX2 shows significantly lower expression in deciduas from pregnancies complicated by both pre-eclampsia and FGR as compared with controls.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKKTRSTTLRRAWPSSDFSDRASDRMRSRSEKDYRLHKRFPAAFAPQASRGYMTSGDVSPISMSPISQSQ      1 - 70
FIPLGEILCLAISAMNSARKPVTQEALMEHLTTCFPGVPTPSQEILRHTLNTLVRERKIYPTPDGYFIVT     71 - 140
PQTYFITPSLIRTNSKWYHLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTH    141 - 210
APTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPKDSEKQSKKFGLKLFRLSFKKDKT    211 - 280
KQLANFSAQFPPEEWPLRDEDTPATIPREVEMEIIRRINPDLTVENVMRHTALMKKLEEEKAQRSKAGSS    281 - 350
AHHSGRSKKSRTHRKSHGKSRSHSKTRVSKGDPSDGSHLDIPAEREYDFCDPLTRVPREGCFIIEHKGDN    351 - 420
FIMHSNTNVLESHFPMTPEWDVSGELAKRRTEMPFPEPSRGSSHSKVHRSHSHTQDRRSRNERSNKAKER    421 - 490
SRSMDNSKGPLGASSLGTPEDLAEGCSQDDQTPSQSYIDDSTLRPAQTVSLQRAHISSTSYKEVCIPEIV    491 - 560
SGSKEPSSACSLLEPGKPPESLPSYGELNSCPTKTATDDYFQCNTSSETVLTAPSPLGKNKEDHDTLTLA    561 - 630
EGVKKLSPSDRQVPHSSREPVGHKEESPKGPGGGPAASGGVAEGIANGRLVQHHGAEPSSLDKRKEIFSK    631 - 700
DTLFKPLHSTLSVNSYHKSSLSLLKSHPKTPADTLPGRCEKLEPSLGTSAAQAMPASQRQQESGGNQEAS    701 - 770
FDYYNVSDDDDSEEGANKNTEEEKNREDVGTMQWLLEREKERDLQRKFEKNLTLLAPKETDSSSNQRATH    771 - 840
SARLDSMDSSSITVDSGFNSPRTRESLASNTSSIVESNRRQNPALSPAHGGAGPAFNFRASAEPPTNEAE    841 - 910
KLQKPSNCLQASVTSV                                                          911 - 926
//

Text Mined References (8)

PMID Year Title
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
20643876 2010 STOX2 but not STOX1 is differentially expressed in decidua from pre-eclamptic women: data from the Second Nord-Trondelag Health Study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.