Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.94
PubTator Score 150.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.500 6.7e-05
astrocytic glioma -1.400 2.3e-03
Astrocytoma, Pilocytic -2.300 3.5e-08
atypical teratoid / rhabdoid tumor -1.800 4.3e-04
ependymoma -3.000 2.3e-21
glioblastoma -2.400 1.2e-10
lung carcinoma 2.300 3.6e-46
medulloblastoma, large-cell -2.300 1.8e-02
osteosarcoma 1.024 9.9e-04
psoriasis -3.200 1.9e-44
sonic hedgehog group medulloblastoma -1.200 4.8e-02

Gene RIF (1)

AA Sequence

MLMPLCGLLWWWWCCCSGWYCYGLCAPAPQMLRHQGLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQP      1 - 70
PGLAANNTLPALGAGGWAGWRGPREVVGREPPPVPPPPPLPPSSVEDDWGGPATEPPASLLSSASSDDFC     71 - 140
KEKTEDRYSLGSSLDSGMRTPLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYY    141 - 210
KYHVIAISTKNPLQWQAISLTVIEKVQVAAAILGSLFLIASISWLIWSTFSPSARWQRQDLLFQICYGMY    211 - 280
GFMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEE    281 - 350
TAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSPPGSSRELVMRVTTV              351 - 410
//

Text Mined References (8)

PMID Year Title