Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.94
PubTator Score 150.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.002
glioblastoma -2.400 0.000
osteosarcoma 1.024 0.001
posterior fossa group B ependymoma -3.100 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.300 0.018
adult high grade glioma -2.500 0.000
pilocytic astrocytoma -2.400 0.000
sonic hedgehog group medulloblastoma -1.200 0.048
lung carcinoma 2.300 0.000
psoriasis -3.200 0.000

Synonym

Accession Q9P2E8 Q4KMN7 Q86WR8
Symbols RNF174
MARCH-IV

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
21151997 Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes

AA Sequence

MLMPLCGLLWWWWCCCSGWYCYGLCAPAPQMLRHQGLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQP      1 - 70
PGLAANNTLPALGAGGWAGWRGPREVVGREPPPVPPPPPLPPSSVEDDWGGPATEPPASLLSSASSDDFC     71 - 140
KEKTEDRYSLGSSLDSGMRTPLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYY    141 - 210
KYHVIAISTKNPLQWQAISLTVIEKVQVAAAILGSLFLIASISWLIWSTFSPSARWQRQDLLFQICYGMY    211 - 280
GFMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEE    281 - 350
TAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSPPGSSRELVMRVTTV              351 - 410
//

Text Mined References (8)

PMID Year Title
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
21151997 2010 Membrane-Associated RING-CH proteins associate with Bap31 and target CD81 and CD44 to lysosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14722266 2004 Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.