Property Summary

NCBI Gene PubMed Count 47
Grant Count 8
R01 Count 3
Funding $259,330.59
PubMed Score 53.03
PubTator Score 49.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma -2.000 0.047
posterior fossa group A ependymoma -1.800 0.005
medulloblastoma -4.600 0.000
medulloblastoma, large-cell -4.600 0.002
adrenocortical adenoma -1.731 0.000
adrenocortical carcinoma -1.724 0.000
aldosterone-producing adenoma -1.083 0.008
subependymal giant cell astrocytoma -1.910 0.034
lung carcinoma 1.500 0.000
pituitary cancer 2.500 0.008
psoriasis -1.200 0.000

Gene RIF (36)

PMID Text
26970279 Results suggest that protocadherin 10 (PCDH10)-Dishevelled, EGL-10 and Pleckstrin domain containing 1 (DEPDC1)-caspase signaling may be a novel regulatory axis in endometrial endometrioid carcinoma (EEC) development.
26927373 Data show that protocadherin 10 (PCDH10) over-expression could significantly induce cell apoptosis, and restrain proliferation, invasion and migration ability of BXPC-3 pancreatic cancer cells.
26881880 PCDH10 methylation in serum is a potential prognostic biomarker for prostate cancer.
26679037 Study found that hypermethylation of CpG probes in the promoter regions of HOXA9 and PCDH10 was associated with mature B-cell neoplasms.
26406945 Our present findings suggested that the hypermethylated CpG site counts of PCDH10 DNA promoter for evaluating the prognosis of GC was reasonable by using the D-BGS
26276761 PCDH10 methylation is a potential biomarker that predicts a poor prognosis after curative resection of pathological stage I non-small-cell lung cancer.
26081897 PCDH10 antagonized MM cell proliferation via the downregulation of Wnt/beta-catenin/BCL-9 signaling, whereas PCDH10 repressed the expression of AKT to promote the expression of GSK3beta and then to restrain the activation of beta-catenin
25590240 These results suggest an important role of p53 in regulating tumor cell migration through activating PCDH10 expression.
25260683 Gastric cancer patients with 5 or more methylated CpG sites of PCDH10 promoter had significantly poorer survival.
25086586 Aberrant methylation of PCDH10 predicts worse biochemical recurrence-free survival in patients with prostate cancer after radical prostatectomy.
More...

AA Sequence

MIVLLLFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLET      1 - 70
GVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTR     71 - 140
FPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGG    141 - 210
GVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEG    211 - 280
QNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLD    281 - 350
ANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAP    351 - 420
LDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDR    421 - 490
DEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATV    491 - 560
NILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMNLFR    561 - 630
MDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQ    631 - 700
RPSRSGGGETSLDLTLILIIALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCCGGGGSTC    701 - 770
CGRQARARKKKLSKSDIMLVQSSNVPSNPAQVPIEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKPC    771 - 840
SPSRSTDTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQRAELSYLVDRPRRVNSSAFQEADIVSSKD    841 - 910
SGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHSDRCWMPSFVPSDGRQAADYRSNLHVPGMDS    911 - 980
VPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNTRAPYKPPYLTRKRIC              981 - 1040
//

Text Mined References (49)

PMID Year Title
26970279 2016 Protocadherin 10 inhibits cell proliferation and induces apoptosis via regulation of DEP domain containing 1 in endometrial endometrioid carcinoma.
26927373 2016 [Protocadherin 10 (PCDH10) inhibits the proliferation, invasion and migration ability of BXPC-3 pancreatic cancer cells].
26881880 2016 Prognostic Value of Protocadherin10 (PCDH10) Methylation in Serum of Prostate Cancer Patients.
26679037 2016 Global measures of peripheral blood-derived DNA methylation as a risk factor in the development of mature B-cell neoplasms.
26406945 2015 Evaluating the clinical feasibility: The direct bisulfite genomic sequencing for examination of methylated status of protocadherin10 (PCDH10) promoter to predict the prognosis of gastric cancer.
26276761 2015 Prognostic signature of protocadherin 10 methylation in curatively resected pathological stage I non-small-cell lung cancer.
26081897 2015 PCDH10 inhibits cell proliferation of multiple myeloma via the negative regulation of the Wnt/?-catenin/BCL-9 signaling pathway.
25590240 2015 PCDH10, a novel p53 transcriptional target in regulating cell migration.
25260683 2014 Clinical significance of the methylated cytosine-phosphate-guanine sites of protocadherin-10 promoter for evaluating the prognosis of gastric cancer.
25086586 2014 Aberrant methylation of PCDH10 predicts worse biochemical recurrence-free survival in patients with prostate cancer after radical prostatectomy.
More...