Property Summary

NCBI Gene PubMed Count 49
PubMed Score 63.80
PubTator Score 49.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical adenoma -1.060 2.4e-04
adrenocortical carcinoma -1.033 1.8e-05
aldosterone-producing adenoma -1.083 7.6e-03
ependymoma -1.400 3.6e-03
glioblastoma -1.900 3.6e-02
group 3 medulloblastoma -1.200 1.6e-02
lung carcinoma 1.500 4.7e-10
medulloblastoma, large-cell -1.100 1.5e-02
pituitary cancer 1.400 2.3e-02
psoriasis -1.200 4.6e-16
subependymal giant cell astrocytoma -1.910 3.4e-02

Gene RIF (38)

AA Sequence

MIVLLLFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLET      1 - 70
GVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTR     71 - 140
FPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGG    141 - 210
GVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEG    211 - 280
QNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLD    281 - 350
ANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAP    351 - 420
LDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDR    421 - 490
DEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATV    491 - 560
NILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMNLFR    561 - 630
MDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQ    631 - 700
RPSRSGGGETSLDLTLILIIALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCCGGGGSTC    701 - 770
CGRQARARKKKLSKSDIMLVQSSNVPSNPAQVPIEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKPC    771 - 840
SPSRSTDTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQRAELSYLVDRPRRVNSSAFQEADIVSSKD    841 - 910
SGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHSDRCWMPSFVPSDGRQAADYRSNLHVPGMDS    911 - 980
VPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNTRAPYKPPYLTRKRIC              981 - 1040
//

Text Mined References (51)

PMID Year Title