Property Summary

NCBI Gene PubMed Count 18
Grant Count 31
R01 Count 29
Funding $3,338,613.3
PubMed Score 105.15
PubTator Score 63.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26421900 Expression of KIF17 in schizophrenic postmortem brains was significantly lower than controls. Both genotypic distribution and allelic frequency of rs2296225 polymorphism were significantly different between the chronic schizophrenia subjects and controls.
25613138 The gene expression of kinesin family member 17 is significantly upregulated in clade B treated SK-N-MC neuroblastoma cells but downregulated in clade C Tat treated SK-N-MC neuroblastoma cells
24072717 although EB1 and KIF17-Tail may coordinate KIF17 catalytic activity, our data reveal a novel and direct role for KIF17 in regulating MT dynamics.
20696710 Depletion of KIF17 from cells growing in three-dimensional matrices results in aberrant epithelial cysts that fail to generate a single central lumen and to polarize apical markers.
20646681 This study suggested that disruption of KIF17, although rare, could result in a schizophrenia phenotype and emphasize the possible involvement of rare de novo mutations in this disorder.
20530208 Data show that the homodimeric kinesin-2 motor KIF17 is kept in an inactive state in the absence of cargo, and define two molecular mechanisms that contribute to autoinhibition of KIF17.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
19679349 The intense placental expression of KIFC1 in syncytiotrophoblast and KIF17 in vascular endothelium suggests that both proteins might be important in a cargo-transport system. KIFC1 and KIF17 expression are increased of both in preeclamptia and diabetes.
18976975 Knockdown of kinesin family member 17 (KIF17) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHVDHVTEQIYNE      1 - 70
IAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYL     71 - 140
EIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRS    141 - 210
HSIFTISIEMSAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDG    211 - 280
RCKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALL    281 - 350
REYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARL    351 - 420
KADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRKETEAVLQVGVLYKAEVMSRAEFASSAEYPPAF    421 - 490
QYETVVKPKVFSTTDTLPSDDVSKTQVSSRFAELPKVEPSKSEISLGSSESSSLEETSVSEAFPGPEEPS    491 - 560
NVEVSMPTEESRSRYFLDECLGQEAAGHLLGEQNYLPQEEPQEVPLQGLLGLQDPFAEVEAKLARLSSTV    561 - 630
ARTDAPQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEVDLASEVALEVVRTAEPGVWLEAQAP    631 - 700
VALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRR    701 - 770
KRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEK    771 - 840
IDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVS    841 - 910
TGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLS    911 - 980
CPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEPL                         981 - 1029
//

Text Mined References (18)

PMID Year Title
26421900 2015 A decrease in protein level and a missense polymorphism of KIF17 are associated with schizophrenia.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24072717 2013 Direct regulation of microtubule dynamics by KIF17 motor and tail domains.
20696710 2010 KIF17 stabilizes microtubules and contributes to epithelial morphogenesis by acting at MT plus ends with EB1 and APC.
20646681 2010 De novo truncating mutation in Kinesin 17 associated with schizophrenia.
20530208 2010 Autoinhibition of the kinesin-2 motor KIF17 via dual intramolecular mechanisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19679349 2009 The presence of kinesin superfamily motor proteins KIFC1 and KIF17 in normal and pathological human placenta.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...